Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Adaptin Ear-Binding Coat-Associated Protein 2/NECAP2 (N, C-6His)

Source: E. coli. MW :31.5kD. Recombinant Human NECAP2 is produced by our E.coli expression system and the target gene encoding Met1-Phe263 is expressed with a 6His tag at the N-terminus, 6His tag at the C-terminus. NECAP2 belongs to the NECAP family. The WXXF motifs mediate binding of accessory proteins to the ear-domain of AP-1, GGAs and AP-2 through hydrophobic interactions. Adaptin ear-binding coat-associated protein 2 can interacts with AP1G1 and AP2A1 components of the adapter protein complex AP-1 and AP-2. It also interacts with the GAE domain proteins GGA1, GGA2 and GGA3.

Product Specifications

Gene Name

NECAP2

Gene ID

55707

UniProt

Q9NVZ3

Components

Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMEESGYESVLCVKPDVHVYRIPPRATNRGYRAAEWQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQAPVDQFPGTAVESVTDSSRYFVIRIEDGNGRRAFIGIGFGDRGDAFDFNVALQDHFKWVKQQCEFAKQAQNPDQGPKLDLGFKEGQTIKLNIANMKKKEGAAGNPRVRPASTGGLSLLPPPPGGKTSTLIPPPGEQLAVGGSLVQPAVAPSSGGAPVPWPQPNPATADIWGDFTKSTGSTSSQTQPGTGWVQFLEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rat Monocyte Chemotactic Protein 1 ELISA Kit
MBS103250-01 48 Well

Rat Monocyte Chemotactic Protein 1 ELISA Kit

Ask
View Details
Rat Monocyte Chemotactic Protein 1 ELISA Kit
MBS103250-02 96 Well

Rat Monocyte Chemotactic Protein 1 ELISA Kit

Ask
View Details
Rat Monocyte Chemotactic Protein 1 ELISA Kit
MBS103250-03 5x 96 Well

Rat Monocyte Chemotactic Protein 1 ELISA Kit

Ask
View Details
Rat Monocyte Chemotactic Protein 1 ELISA Kit
MBS103250-04 10x 96 Well

Rat Monocyte Chemotactic Protein 1 ELISA Kit

Ask
View Details
SLC6A3 Antibody
GWB-MP600F 50 µg

SLC6A3 Antibody

Ask
View Details
Recombinant Brevibacillus brevis 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase (dapH)
MBS1074579-01 0.02 mg (E-Coli)

Recombinant Brevibacillus brevis 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase (dapH)

Ask
View Details