Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Guanidinoacetate N-Methyltransferase/GAMT (N, C-6His)

Source: E. coli. MW :29.5kD. Recombinant Human GAMT is produced by our E.coli expression system and the target gene encoding Met1-Gly236 is expressed with a 6His tag at the N-terminus, 6His tag at the C-terminus. GAMT is a methyltransferase which belongs to the class I-like SAM-binding methyltransferase superfamily. It contains one RMT2 (arginine N-methyltransferase 2-like) domain and is expressed in liver. GAMT converts guanidoacetate to creatine, using S-adenosylmethionine as the methyl donor. Defects in GAMT are the cause of guanidinoacetate methyltransferase deficiency, which is an autosomal recessive disorder characterized by developmental delay/regression, mental retardation, severe disturbance of expressive and cognitive speech, intractable seizures and movement disturbances, severe depletion of creatine/phosphocreatine in the brain, and accumulation of guanidinoacetic acid in brain and body fluids.

Product Specifications

Gene Name

GAMT

Gene ID

2593

UniProt

Q14353

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,1mMDTT, pH 8.0 .

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYMHALAAAASSKGGRVLEVGFGMAIAASKVQEAPIDEHWIIECNDGVFQRLRDWAPRQTHKVIPLKGLWEDVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVPALLEAGFRRENIRTEVMALVPPADCRYYAFPQMITPLVTKGLEHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

Defb33 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6303105 3x 1.0 µg

Defb33 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Hsa-miR-181b-5p mimic
HY-R00332-01 5 nmol

Hsa-miR-181b-5p mimic

Sign In for Pricing
View Details
Hsa-miR-181b-5p mimic
HY-R00332-02 20 nmol

Hsa-miR-181b-5p mimic

Sign In for Pricing
View Details
NRG4 (NM_138573) Human Over-expression Lysate
LC403362 20 µg

NRG4 (NM_138573) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit Anti-CDK10 antibody
SL2361R-01 50 µL

Rabbit Anti-CDK10 antibody

Sign In for Pricing
View Details
Rabbit Anti-CDK10 antibody
SL2361R-02 100 µL

Rabbit Anti-CDK10 antibody

Sign In for Pricing
View Details