Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Calreticulin-3/CALR3/CRT2

Source: E. coli. MW :42.9kD. Recombinant Human calreticulin-3 is produced by our E.coli expression system and the target gene encoding Thr20-Leu384 is expressed. Calreticulin-3 belongs to the calreticulin family, members of which are calcium binding chaperones localized mainly in the endoplasmic reticulum. It can be divided into a N-terminal globular domain, a proline-rich P-domain forming an elongated arm-like structure and a C-terminal acidic domain. During spermatogenesis process, Calreticulin-3 may act as a lectin-independent chaperone for specific client proteins such as ADAM3. Defects in CALR3 are the cause of familial hypertrophic cardiomyopathy type 19 (CMH19), it is a hereditary heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum. The symptoms include dyspnea, syncope, collapse, palpitations, and chest pain.

Product Specifications

Gene Name

CALR3

Gene ID

125972

UniProt

Q96L12

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MTVYFQEEFLDGEHWRNRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADIDQKNLNGKSQYYIMFGPDICGFDIKKVHVILHFKNKYHENKKLIRCKVDGFTHLYTLILRPDLSYDVKIDGQSIESGSIEYDWNLTSLKKETSPAESKDWEQTKDNKAQDWEKHFLDASTSKQSDWNGDLDGDWPAPMLQKPPYQDGLKPEGIHKDVWLHRKMKNTDYLTQYDLSEFENIGAIGLELWQVRSGTIFDNFLITDDEEYADNFGKATWGETKGPEREMDAIQAKEEMKKAREEEEEELLSGKINRHEHYFNQFHRRNEL
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

a (NM_015770) Mouse Tagged Lenti ORF Clone
MR227643L3 10 µg

a (NM_015770) Mouse Tagged Lenti ORF Clone

Ask
View Details
SYTL2 (NM_032379) Human Recombinant Protein
TP318076L 1 mg

SYTL2 (NM_032379) Human Recombinant Protein

Ask
View Details
MMP13 Blocking Peptide
MBS822998-01 1 mg

MMP13 Blocking Peptide

Ask
View Details
MMP13 Blocking Peptide
MBS822998-02 5 mg

MMP13 Blocking Peptide

Ask
View Details
MMP13 Blocking Peptide
MBS822998-03 5x 5 mg

MMP13 Blocking Peptide

Ask
View Details
Lentiviral mouse Pard3b shRNA (UAS) - Lentiviral mouse Pard3b shRNA (UAS, GFP) plasmid
GTR15154054 1 Vial

Lentiviral mouse Pard3b shRNA (UAS) - Lentiviral mouse Pard3b shRNA (UAS, GFP) plasmid

Ask
View Details