Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Endoglin/CD105 (N-Trx, 6His)

Source: E. coli. MW :33.6kD. Recombinant Human Endoglin is produced by our E.coli expression system and the target gene encoding Glu26-Gln176 is expressed with a Trx, 6His tag at the N-terminus. Endoglin is a single-pass type I membrane protein which restricted to endothelial cells in all tissues except bone marrow. Endoglin as major glycoprotein of vascular endothelium, it has been found on endothelial cells, activated macrophages, fibroblasts, and smooth muscle cells. Furthermore, Homodimer forms a heteromeric complex with the signaling receptors for transforming growth factor-beta: TGFBR1 and/or TGFBR2. It may have an important role in the binding of endothelial cells to integrins and/or other RGD receptors. Defects in ENG are the cause of hereditary hemorrhagic telangiectasia type 1 (HHT1), which is an autosomal dominant multisystemic vascular dysplasia, characterized by recurrent epistaxis, muco-cutaneous telangiectases, gastro-intestinal hemorrhage, and pulmonary (PAVM), cerebral (CAVM) and hepatic arteriovenous malformations.

Product Specifications

Gene Name

ENG

Gene ID

2022

UniProt

P17813

Components

Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMETVHCDLQPVGPERDEVTYTTSQVSKGCVAQAPNAILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTELPSFPKTQILEWAAERGPITSAAELNDPQSILLRLGQAQ
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ERK1 Rabbit Polyclonal Antibody
JOT-AP08978-01 50ul

ERK1 Rabbit Polyclonal Antibody

Ask
View Details
ERK1 Rabbit Polyclonal Antibody
JOT-AP08978-02 100ul

ERK1 Rabbit Polyclonal Antibody

Ask
View Details
NME3 antibody
FNab05764 100 µg

NME3 antibody

Ask
View Details
TNIK Human Pre-designed siRNA Set A
HY-RS14831 1 Set

TNIK Human Pre-designed siRNA Set A

Ask
View Details
RBM15B Protein Vector (Human) (pPM-C-HA)
38601021 500 ng

RBM15B Protein Vector (Human) (pPM-C-HA)

Ask
View Details