Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Endoglin/CD105 (N-Trx, 6His)

Source: E. coli. MW :33.6kD. Recombinant Human Endoglin is produced by our E.coli expression system and the target gene encoding Glu26-Gln176 is expressed with a Trx, 6His tag at the N-terminus. Endoglin is a single-pass type I membrane protein which restricted to endothelial cells in all tissues except bone marrow. Endoglin as major glycoprotein of vascular endothelium, it has been found on endothelial cells, activated macrophages, fibroblasts, and smooth muscle cells. Furthermore, Homodimer forms a heteromeric complex with the signaling receptors for transforming growth factor-beta: TGFBR1 and/or TGFBR2. It may have an important role in the binding of endothelial cells to integrins and/or other RGD receptors. Defects in ENG are the cause of hereditary hemorrhagic telangiectasia type 1 (HHT1), which is an autosomal dominant multisystemic vascular dysplasia, characterized by recurrent epistaxis, muco-cutaneous telangiectases, gastro-intestinal hemorrhage, and pulmonary (PAVM), cerebral (CAVM) and hepatic arteriovenous malformations.

Product Specifications

Gene Name

ENG

Gene ID

2022

UniProt

P17813

Components

Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMETVHCDLQPVGPERDEVTYTTSQVSKGCVAQAPNAILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTELPSFPKTQILEWAAERGPITSAAELNDPQSILLRLGQAQ
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human CD42a AssayLite™ Antibody (RPE Conjugate)
32156-05151 5x 30 µg

Human CD42a AssayLite™ Antibody (RPE Conjugate)

Ask
View Details
Bcl2l2 (NM_007537) Mouse Tagged Lenti ORF Clone
MR220491L3 10 µg

Bcl2l2 (NM_007537) Mouse Tagged Lenti ORF Clone

Ask
View Details
Scrn2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
43203114 3x 1.0 µg

Scrn2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Ask
View Details
Human Coiled-coil domain-containing protein 82 ELISA Kit
MBS2884449-01 48 Well

Human Coiled-coil domain-containing protein 82 ELISA Kit

Ask
View Details
Human Coiled-coil domain-containing protein 82 ELISA Kit
MBS2884449-02 96 Well

Human Coiled-coil domain-containing protein 82 ELISA Kit

Ask
View Details
Human Coiled-coil domain-containing protein 82 ELISA Kit
MBS2884449-03 5x 96 Well

Human Coiled-coil domain-containing protein 82 ELISA Kit

Ask
View Details