Recombinant Human Interleukin-25/IL25/MYDGF (N-6His)
Source: E. coli. MW :18kD. Recombinant Human SF20 is produced by our E.coli expression system and the target gene encoding Ser33-Leu173 is expressed with a 6His tag at the N-terminus. C19orf10 is a secreted protein which belongs to the UPF0556 family. It is expressed in synovial tissue and detected in synovial fluid of patients with arthropaties. C19orf10 plays a role in proliferation of lymphoid cells and is considered an interleukin.
Product Specifications
Gene Name
MYDGF
Gene ID
56005
UniProt
Q969H8
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
MGSSHHHHHHSSGLVPRGSHMSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQGGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAEIEYAMAYSKAAFERESDVPLKTEEFEVTKTAVAHRPGAFKAELSKLVIVAKASRTEL
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
MBS1317235-01 0.02 mg (E-Coli)
Recombinant Macaca fascicularis Activated RNA polymerase II transcriptional coactivator p15 (SUB1)
Ask
View Details 
MBS1317235-02 0.1 mg (E-Coli)
Recombinant Macaca fascicularis Activated RNA polymerase II transcriptional coactivator p15 (SUB1)
Ask
View Details MBS1317235-03 0.02 mg (Yeast)
Recombinant Macaca fascicularis Activated RNA polymerase II transcriptional coactivator p15 (SUB1)
Ask
View Details MBS1317235-04 0.1 mg (Yeast)
Recombinant Macaca fascicularis Activated RNA polymerase II transcriptional coactivator p15 (SUB1)
Ask
View Details MBS1317235-05 0.02 mg (Baculovirus)
Recombinant Macaca fascicularis Activated RNA polymerase II transcriptional coactivator p15 (SUB1)
Ask
View Details