Recombinant Human Interleukin-25/IL25/MYDGF (N-6His)

Source: E. coli. MW :18kD. Recombinant Human SF20 is produced by our E.coli expression system and the target gene encoding Ser33-Leu173 is expressed with a 6His tag at the N-terminus. C19orf10 is a secreted protein which belongs to the UPF0556 family. It is expressed in synovial tissue and detected in synovial fluid of patients with arthropaties. C19orf10 plays a role in proliferation of lymphoid cells and is considered an interleukin.

Product Specifications

Gene Name

MYDGF

Gene ID

56005

UniProt

Q969H8

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQGGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAEIEYAMAYSKAAFERESDVPLKTEEFEVTKTAVAHRPGAFKAELSKLVIVAKASRTEL