Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Syntaxin-8/STX8

Source: E. coli. MW :24.6kD. Recombinant Human Syntaxin-8 is produced by our E.coli expression system and the target gene encoding Met1-Gly215 is expressed. Syntaxin-8 is a single-pass type IV membrane protein which belongs to the syntaxin family. It contains one t-SNARE coil homology domain. STX8 is highly expressed in heart, also found in brain, kidney, liver, lung, placenta, skeletal muscle, spleen and pancreas. STX8 is involved in protein trafficking from early to late endosomes via vesicle fusion and exocytosis. It as a vesicle trafficking protein functions in the early secretory pathway, possibly mediating retrograde transport form cis-golgi membrane to the ER.

Product Specifications

Gene Name

STX8

Gene ID

9482

UniProt

Q9UNK0

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MAPDPWFSTYDSTCQIAQEIAEKIQQRNQYERKGEKAPKLTVTIRALLQNLKEKIALLKDLLLRAVSTHQITQLEGDRRQNLLDDLVTRERLLLASFKNEGAEPDLIRSSLMSEEAKRGAPNPWLFEEPEETRGLGFDEIRQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEKLRNETRRVNMVDRKSASCG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPDC1 (NM_015392) Human Recombinant Protein
TP301415M 100 µg

NPDC1 (NM_015392) Human Recombinant Protein

Sign In for Pricing
View Details
FADS1 Recombinant Antibody, FITC Conjugated
bsm-62440R-FITC 100 µL

FADS1 Recombinant Antibody, FITC Conjugated

Sign In for Pricing
View Details
Recombinant Human TNFSF10/ TRAIL/ APO-2L Protein, Untagged, E.coli-10ug
QP5244-10ug 10ug

Recombinant Human TNFSF10/ TRAIL/ APO-2L Protein, Untagged, E.coli-10ug

Sign In for Pricing
View Details
Recombinant Human Collagen α-1 (VIII) Chain/COL8A1 (C-6His)
C940-500ug 500 µg

Recombinant Human Collagen α-1 (VIII) Chain/COL8A1 (C-6His)

Sign In for Pricing
View Details
CDK11 Rabbit Polyclonal Antibody (BF488)
orb1815301 100 µL

CDK11 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
PRDX4 Antibody
OAAN00362-50UL 50 µL

PRDX4 Antibody

Sign In for Pricing
View Details