Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Syntaxin-8/STX8

Source: E. coli. MW :24.6kD. Recombinant Human Syntaxin-8 is produced by our E.coli expression system and the target gene encoding Met1-Gly215 is expressed. Syntaxin-8 is a single-pass type IV membrane protein which belongs to the syntaxin family. It contains one t-SNARE coil homology domain. STX8 is highly expressed in heart, also found in brain, kidney, liver, lung, placenta, skeletal muscle, spleen and pancreas. STX8 is involved in protein trafficking from early to late endosomes via vesicle fusion and exocytosis. It as a vesicle trafficking protein functions in the early secretory pathway, possibly mediating retrograde transport form cis-golgi membrane to the ER.

Product Specifications

Gene Name

STX8

Gene ID

9482

UniProt

Q9UNK0

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MAPDPWFSTYDSTCQIAQEIAEKIQQRNQYERKGEKAPKLTVTIRALLQNLKEKIALLKDLLLRAVSTHQITQLEGDRRQNLLDDLVTRERLLLASFKNEGAEPDLIRSSLMSEEAKRGAPNPWLFEEPEETRGLGFDEIRQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEKLRNETRRVNMVDRKSASCG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DUSP15 (NM_177991) Human Recombinant Protein
E45H35697M5 20 µg

DUSP15 (NM_177991) Human Recombinant Protein

Sign In for Pricing
View Details
CD11a (Integrin Alpha L, ITGAL, Leukocyte Adhesion Glycoprotein LFA1 Alpha Chain, LFA1A, Ly15, Ly21, Lymphocyte Function Associated Antigen Type 1 alpha, p180) (AP) discontinued
C2262-06N-AP 100 µL

CD11a (Integrin Alpha L, ITGAL, Leukocyte Adhesion Glycoprotein LFA1 Alpha Chain, LFA1A, Ly15, Ly21, Lymphocyte Function Associated Antigen Type 1 alpha, p180) (AP) discontinued

Sign In for Pricing
View Details
Mouse NEFL ELISA Kit
CEK2979 96 Tests

Mouse NEFL ELISA Kit

Sign In for Pricing
View Details
ELAVL3 Antibody
OAAN01617-100UL 100 µL

ELAVL3 Antibody

Sign In for Pricing
View Details
NIDDM2 ORF Vector (Human) (pORF)
ORF026096 1.0 µg DNA

NIDDM2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Arg-Gly-Glu-Ser acetate (93674-97-6 free base)
orb1296604-01 5 mg

Arg-Gly-Glu-Ser acetate (93674-97-6 free base)

Sign In for Pricing
View Details