Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Chloride Intracellular Channel Protein 3/CLIC3 (C-6His)

Source: E. coli. MW :27.7kD. Recombinant Human CLIC3 is produced by our E.coli expression system and the target gene encoding Met1-Arg236 is expressed with a 6His tag at the C-terminus. Chloride intracellular channel protein 3 (CLIC3) is encoded by the CLIC3 gene. CLIC3 is a single-pass membrane protein which belongs to the chloride channel CLIC family. It contains one GST C-terminal domain and one GST N-terminal domain. Chloride intracellular channel protein 3 high expressed in the placental, lung and heart, low expressed in skeletal muscle, kidney and pancreas. Chloride intracellular channel protein 3 can insert into membranes and forms chloride ion channels, may participate in cellular growth control.

Product Specifications

Gene Name

CLIC3

Gene ID

9022

UniProt

O95833

Components

Supplied as a 0.2 μm filtered solution of 10mM Tris, 0.1%Triton100, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPRLEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

FCER1G (NM_004106) Human Tagged ORF Clone Lentiviral Particle
RC207585L3V 200 µL

FCER1G (NM_004106) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
Langerin Antibody / CD207
V4881SAF-100UG 100 µg

Langerin Antibody / CD207

Ask
View Details
Human DUSP7 Knockout A549 cell line
GTR15409291 1 Vial

Human DUSP7 Knockout A549 cell line

Ask
View Details
Human Protein FAM106A (FAM106A) ELISA Kit
abx522611 96 Tests

Human Protein FAM106A (FAM106A) ELISA Kit

Ask
View Details
Metelimumab Biosimilar, Research Grade
ABS-121-100ug 100 µg

Metelimumab Biosimilar, Research Grade

Ask
View Details