Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Early Growth Response Protein 1/EGR1/ZNF225 (N-6His)

Source: E. coli. MW :19.9kD. Recombinant Human Early growth response protein 1 is produced by our E.coli expression system and the target gene encoding Gln282-Ser433 is expressed with a 6His tag at the N-terminus. EGR-1 belongs to the EGR family of C2H2-type zinc finger proteins. It is a nuclear protein and functions as a transcriptional regulator. EGR-1 recognizes and binds to the DNA sequence 5'-CGCCCCCGC-3' (EGR-site) .The products of target genes it activates are required for differentiation and mitogenesis. Studies suggest this is a tumor suppressor gene. EGR-1 has a distinct pattern of expression in the brain, and its induction has been shown to be associated with neuronal activity. Several studies suggest it has a role in neuronal plasticity. EGR-1 has also been found to regulate the expression of synaptobrevin II (a protein important for synaptic exocytosis) .

Product Specifications

Gene Name

EGR1

Gene ID

1958

UniProt

P18146

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMQQPSLTPLSTIKAFATQSGSQDLKALNTSYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQKDKKADKSVVAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (RIV11), CF488A conjugate, 0.1mg/mL
BNC880333-100 1x 100 µL

CD8 (RIV11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF647 conjugate, 0.1mg/mL
BNC470978-100 1x 100 µL

CD7 (T3-3A1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF594 conjugate, 0.1mg/mL
BNC940225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL
BNC470437-500 1x 500 µL

CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF488A conjugate, 0.1mg/mL
BNC881035-100 1x 100 µL

CD8 (C8/1035), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF740 conjugate, 0.1mg/mL
BNC740305-100 1x 100 µL

CD95 (B-R18), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details