Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ankyrin Repeat and SOCS Box Protein 13/ASB13 (N-6His)

Source: E. coli. MW :31.4kD. Recombinant Human ASB13 is produced by our E.coli expression system and the target gene encoding Met1-Asn278 is expressed with a 6His tag at the N-terminus. Ankyrin repeat and SOCS box protein 13 (ASB13) is a member of the ankyrin repeat and SOCS box-containing (ASB) family. ASB13 contain six ankyrin repeats sequence and a SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. ASB13 may be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

Product Specifications

Gene Name

ASB13

Gene ID

79754

UniProt

Q8WXK3

Components

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4, 4M Urea.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MNHKVHHHHHHMEPRAADGCFLGDVGFWVERTPVHEAAQRGESLQLQQLIESGACVNQVTVDSITPLHAASLQGQARCVQLLLAAGAQVDARNIDGSTPLCDACASGSIECVKLLLSYGAKVNPPLYTASPLHEACMSGSSECVRLLIDVGANLEAHDCHFGTPLHVACAREHLDCVKVLLNAGANVNAAKLHETALHHAAKVKNVDLIEMLIEFGGNIYARDNRGKKPSDYTWSSSAPAKCFEYYEKTPLTLSQLCRVNLRKATGVRGLEKIAKLNIPPRLIDYLSYN
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Slc20a2 Mouse Gene Knockout Kit (CRISPR)
KN515920 1 Kit

Slc20a2 Mouse Gene Knockout Kit (CRISPR)

Ask
View Details
Polyclonal Antibody to Noggin (NOG)
MBS2003895-01 0.1 mL

Polyclonal Antibody to Noggin (NOG)

Ask
View Details
Polyclonal Antibody to Noggin (NOG)
MBS2003895-02 0.2 mL

Polyclonal Antibody to Noggin (NOG)

Ask
View Details
Polyclonal Antibody to Noggin (NOG)
MBS2003895-03 0.5 mL

Polyclonal Antibody to Noggin (NOG)

Ask
View Details
Polyclonal Antibody to Noggin (NOG)
MBS2003895-04 1 mL

Polyclonal Antibody to Noggin (NOG)

Ask
View Details
Polyclonal Antibody to Noggin (NOG)
MBS2003895-05 5 mL

Polyclonal Antibody to Noggin (NOG)

Ask
View Details