Recombinant Human Calcitonin/CALCA (C-6His, E. coli)
Source: E. coli. MW :10.5kD. Recombinant Human Calcitonin is produced by our E.coli expression system and the target gene encoding Tyr58-Asn141 is expressed with a 6His tag at the C-terminus. Calcitonin is a secreted protein which belongs to the calcitonin family. Calcitonin is cleaved into the following two chains: Calcitonin and Katacalcin. Katacalcin is a potent plasma calcium-lowering peptide. Calcitonin is a 32-amino acid linear polypeptide hormone. Calcitonin acts to reduce blood calcium (Ca2+), opposing the effects of parathyroid hormone (PTH) . Its importance in humans has not been as well established as its importance in other animals, as its function is usually not significant in the regulation of normal calcium homeostasis. Calcitonin causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones.
Product Specifications
Gene Name
CALCA
Gene ID
796
UniProt
P01258
Components
Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,50% Glycerol, pH7.4.
Shipping Conditions
The product is shipped on dry ice/ice packs.
Storage Conditions
Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
YVQMKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNANVEHHHHHH
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog