Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Calcitonin/CALCA (C-6His, E. coli)

Source: E. coli. MW :10.5kD. Recombinant Human Calcitonin is produced by our E.coli expression system and the target gene encoding Tyr58-Asn141 is expressed with a 6His tag at the C-terminus. Calcitonin is a secreted protein which belongs to the calcitonin family. Calcitonin is cleaved into the following two chains: Calcitonin and Katacalcin. Katacalcin is a potent plasma calcium-lowering peptide. Calcitonin is a 32-amino acid linear polypeptide hormone. Calcitonin acts to reduce blood calcium (Ca2+), opposing the effects of parathyroid hormone (PTH) . Its importance in humans has not been as well established as its importance in other animals, as its function is usually not significant in the regulation of normal calcium homeostasis. Calcitonin causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones.

Product Specifications

Gene Name

CALCA

Gene ID

796

UniProt

P01258

Components

Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,50% Glycerol, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

YVQMKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNANVEHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Synechococcus sp. NAD (P)H-quinone oxidoreductase subunit L (ndhL), partial
MBS7090574 Inquire

Recombinant Synechococcus sp. NAD (P)H-quinone oxidoreductase subunit L (ndhL), partial

Ask
View Details
ZDHHC6 Antibody, HRP conjugated
MBS1494348-01 0.05 mg

ZDHHC6 Antibody, HRP conjugated

Ask
View Details
ZDHHC6 Antibody, HRP conjugated
MBS1494348-02 0.1 mg

ZDHHC6 Antibody, HRP conjugated

Ask
View Details
ZDHHC6 Antibody, HRP conjugated
MBS1494348-03 5x 0.1 mg

ZDHHC6 Antibody, HRP conjugated

Ask
View Details
PPLK/GFP+Puro-IRAK1 shRNA-1
PPL00469-3a 1 Each

PPLK/GFP+Puro-IRAK1 shRNA-1

Ask
View Details
Rabbit anti-Escherichia coli O8 (strain IAI1) rplN Polyclonal Antibody
MBS7174644 Inquire

Rabbit anti-Escherichia coli O8 (strain IAI1) rplN Polyclonal Antibody

Ask
View Details