Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Calcitonin/CALCA (C-6His, E. coli)

Source: E. coli. MW :10.5kD. Recombinant Human Calcitonin is produced by our E.coli expression system and the target gene encoding Tyr58-Asn141 is expressed with a 6His tag at the C-terminus. Calcitonin is a secreted protein which belongs to the calcitonin family. Calcitonin is cleaved into the following two chains: Calcitonin and Katacalcin. Katacalcin is a potent plasma calcium-lowering peptide. Calcitonin is a 32-amino acid linear polypeptide hormone. Calcitonin acts to reduce blood calcium (Ca2+), opposing the effects of parathyroid hormone (PTH) . Its importance in humans has not been as well established as its importance in other animals, as its function is usually not significant in the regulation of normal calcium homeostasis. Calcitonin causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones.

Product Specifications

Gene Name

CALCA

Gene ID

796

UniProt

P01258

Components

Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,50% Glycerol, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

YVQMKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNANVEHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

hsa-miR-6769a-5p miRNA Mimic
MCH03496 2x 2.5 nmol

hsa-miR-6769a-5p miRNA Mimic

Ask
View Details
Rat Hemoglobin (HB) ELISA kit
QY-E10646 96 Tests

Rat Hemoglobin (HB) ELISA kit

Ask
View Details
CD115 (Macrophage Colony-stimulating Factor 1 Receptor, CSF-1 Receptor, CSF-1-R, CSF-1R, M-CSF-R, Proto-oncogene c-Fms, CSF1R, FMS)
139855 200 µL

CD115 (Macrophage Colony-stimulating Factor 1 Receptor, CSF-1 Receptor, CSF-1-R, CSF-1R, M-CSF-R, Proto-oncogene c-Fms, CSF1R, FMS)

Ask
View Details
Integrin alpha 1 Antibody
F51365-0.08ML 0.08 mL

Integrin alpha 1 Antibody

Ask
View Details
GNF-1331
407337 5.0mg

GNF-1331

Ask
View Details
DJ-1 Cell-Based ELISA Kit
CB5206 1 Kit

DJ-1 Cell-Based ELISA Kit

Ask
View Details