Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Resistin/RETN/ADSF (C-6His)

Source: E. coli. MW :10.6kD. Recombinant Human Resistin is produced by our E.coli expression system and the target gene encoding Lys19-Pro108 is expressed with a 6His tag at the C-terminus. Resistin known as adipose tissue-specific secretory factor (ADSF) or C/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein (XCP1) that seems to suppress insulin ability to stimulate glucose uptake into adipose cells. The length of the resistin pre-peptide in human is 108 amino acid residues and in the mouse and rat it is 114 aa; the molecular weight is ~12.5 kDa. Resistin is a cytokine whose physiologic role has been the subject of much controversy regarding its involvement with obesity and type II diabetes mellitus (T2DM) . Resistin has been shown to cause "high levels of 'bad' cholesterol (low-density lipoprotein or LDL), increasing the risk of heart disease, resistin increases the production of LDL in human liver cells and also degrades LDL receptors in the liver. Potentially links obesity to diabetes.

Product Specifications

Gene Name

RETN

Gene ID

56729

UniProt

Q9HD89

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Acetic acid, pH 3.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

KTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQPLEHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (84-3C1), CF405S conjugate, 0.1mg/mL
BNC040342-500 1x 500 µL

CD43 (84-3C1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD2 / Lymphocyte Function Antigen 2 (LFA-2) (UMCD2), CF740 conjugate, 0.1mg/mL
BNC740201-100 1x 100 µL

CD2 / Lymphocyte Function Antigen 2 (LFA-2) (UMCD2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100B (4C4.9), CF640R conjugate, 0.1mg/mL
BNC400143-500 1x 500 µL

S100B (4C4.9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFRvIII (Epidermal Growth Factor Receptor, Variant III) (GFR/2600R), CF594 conjugate, 0.1mg/mL
BNC942600-100 1x 100 µL

EGFRvIII (Epidermal Growth Factor Receptor, Variant III) (GFR/2600R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRP1 (Tyrosinase Related Protein 1) (TYRP1/807), CF488A conjugate, 0.1mg/mL
BNC880807-500 1x 500 µL

TRP1 (Tyrosinase Related Protein 1) (TYRP1/807), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (2755-8), CF594 conjugate, 0.1mg/mL
BNC940091-500 1x 500 µL

Fibronectin (2755-8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details