Recombinant Human Resistin/RETN/ADSF (C-6His)
Source: E. coli. MW :10.6kD. Recombinant Human Resistin is produced by our E.coli expression system and the target gene encoding Lys19-Pro108 is expressed with a 6His tag at the C-terminus. Resistin known as adipose tissue-specific secretory factor (ADSF) or C/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein (XCP1) that seems to suppress insulin ability to stimulate glucose uptake into adipose cells. The length of the resistin pre-peptide in human is 108 amino acid residues and in the mouse and rat it is 114 aa; the molecular weight is ~12.5 kDa. Resistin is a cytokine whose physiologic role has been the subject of much controversy regarding its involvement with obesity and type II diabetes mellitus (T2DM) . Resistin has been shown to cause "high levels of 'bad' cholesterol (low-density lipoprotein or LDL), increasing the risk of heart disease, resistin increases the production of LDL in human liver cells and also degrades LDL receptors in the liver. Potentially links obesity to diabetes.
Product Specifications
Gene Name
RETN
Gene ID
56729
UniProt
Q9HD89
Components
Lyophilized from a 0.2 μm filtered solution of 20mM Acetic acid, pH 3.0.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
KTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQPLEHHHHHH
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items