Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tumor Necrosis Factor Receptor I/TNFRSF1A/CD120a

Source: E. coli. MW :21.2kD. Recombinant Mouse Tumor Necrosis Factor Receptor I is produced by our E.coli expression system and the target gene encoding Ile22-Ala212 is expressed. Tumor necrosis factor receptor superfamily member 1A (Tnfrsf1a) is a member of the tumor necrosis factor receptor superfamily. Tnfrsf1a is one of the major receptors for the tumor necrosis factor-alpha. It can activate the transcription factor NF-?B, mediate apoptosis, and function as a regulator of inflammation. Antiapoptotic protein BCL2-associated athanogene 4 (BAG4/SODD) and adaptor proteins TRADD and TRAF2 have been shown to interact with this receptor, and thus play regulatory roles in the signal transduction mediated by the receptor. Germline mutations of the extracellular domains of this receptor were found to be associated with the human genetic disorder called tumor necrosis factor associated periodic syndrome (TRAPS) or periodic fever syndrome.

Product Specifications

Gene Name

Tnfrsf1a

Gene ID

21937

UniProt

P25118

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MIHPSGVTGLVPSLGDREKRDSLCPQGKYVHSKNNSICCTKCHKGTYLVSDCPSPGRDTVCRECEKGTFTASQNYLRQCLSCKTCRKEMSQVEISPCQADKDTVCGCKENQFQRYLSETHFQCVDCSPCFNGTVTIPCKETQNTVCNCHAGFFLRESECVPCSHCKKNEECMKLCLPPPLANVTNPQDSGTA
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

FLY26
MF-0115092-01 10 mg

FLY26

Ask
View Details
FLY26
MF-0115092-02 50 mg

FLY26

Ask
View Details
Aldose reductase-IN-1 25mg
A20976-25 25 mg

Aldose reductase-IN-1 25mg

Ask
View Details
Rabbit Anti-A1AG1/ORM1 Polyclonal Antibody
PAV234 100 μL

Rabbit Anti-A1AG1/ORM1 Polyclonal Antibody

Ask
View Details
IL10 Antibody
MBS5312515-01 0.1 mg

IL10 Antibody

Ask
View Details
IL10 Antibody
MBS5312515-02 5x 0.1 mg

IL10 Antibody

Ask
View Details