Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NEDD8-Conjugating Enzyme UBC12/UBE2M

Source: E. coli. MW :20.9kD. Recombinant Human Ubiquitin-conjugating Enzyme E2M is produced by our E.coli expression system and the target gene encoding Met1-Lys183 is expressed. UBE2M is a member of the E2 ubiquitin-conjugating enzyme family. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This protein is linked with a ubiquitin-like protein, NEDD8, which can be conjugated to cellular proteins, such as Cdc53/culin. UBE2M accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction with the E3 ubiquitin ligase RBX1, but not RBX2, suggests that the RBX1-UBE2M complex neddylates specific target proteins, such as CUL1, CUL2, CUL3 and CUL4. It involved in cell proliferation and is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation.

Product Specifications

Gene Name

UBE2M

Gene ID

9040

UniProt

P61081

Components

Supplied as a 0.2 μm filtered solution of 50mM HEPES, pH 7.5,2mM DTT,150mM NaCl,10%glycerol .

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK
More Discoveries

Explore Other Products

Browse additional items from our catalog

AK3P2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0065105 3x 1.0 µg

AK3P2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Eicosapentaenoic Acid. Discontinued. See 274877
011051 2.5 mg

Eicosapentaenoic Acid. Discontinued. See 274877

Sign In for Pricing
View Details
Procollagen III N-Terminal Propeptide (PIIINP) Monoclonal Antibody
CAU37556-01 100 µL

Procollagen III N-Terminal Propeptide (PIIINP) Monoclonal Antibody

Sign In for Pricing
View Details
Procollagen III N-Terminal Propeptide (PIIINP) Monoclonal Antibody
CAU37556-02 200 µL

Procollagen III N-Terminal Propeptide (PIIINP) Monoclonal Antibody

Sign In for Pricing
View Details
Procollagen III N-Terminal Propeptide (PIIINP) Monoclonal Antibody
CAU37556-03 1 mL

Procollagen III N-Terminal Propeptide (PIIINP) Monoclonal Antibody

Sign In for Pricing
View Details
Canine Ovalbumin IgE antibody (OVA-IgE Ab) ELISA Kit
YP-W200806-01 48 Tests

Canine Ovalbumin IgE antibody (OVA-IgE Ab) ELISA Kit

Sign In for Pricing
View Details