Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NEDD8-Conjugating Enzyme UBC12/UBE2M

Source: E. coli. MW :20.9kD. Recombinant Human Ubiquitin-conjugating Enzyme E2M is produced by our E.coli expression system and the target gene encoding Met1-Lys183 is expressed. UBE2M is a member of the E2 ubiquitin-conjugating enzyme family. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This protein is linked with a ubiquitin-like protein, NEDD8, which can be conjugated to cellular proteins, such as Cdc53/culin. UBE2M accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction with the E3 ubiquitin ligase RBX1, but not RBX2, suggests that the RBX1-UBE2M complex neddylates specific target proteins, such as CUL1, CUL2, CUL3 and CUL4. It involved in cell proliferation and is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation.

Product Specifications

Gene Name

UBE2M

Gene ID

9040

UniProt

P61081

Components

Supplied as a 0.2 μm filtered solution of 50mM HEPES, pH 7.5,2mM DTT,150mM NaCl,10%glycerol .

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK
More Discoveries

Explore Other Products

Browse additional items from our catalog

GnT-I Double Nickase Plasmid (m)
sc-421642-NIC 20 µg

GnT-I Double Nickase Plasmid (m)

Sign In for Pricing
View Details
3,4-Dimethoxyphenylglyoxal hydrate
270712-01 5 g

3,4-Dimethoxyphenylglyoxal hydrate

Sign In for Pricing
View Details
3,4-Dimethoxyphenylglyoxal hydrate
270712-02 10 g

3,4-Dimethoxyphenylglyoxal hydrate

Sign In for Pricing
View Details
Renin [1N16] Mouse mAb
MBS435320-01 0.2 mg

Renin [1N16] Mouse mAb

Sign In for Pricing
View Details
Renin [1N16] Mouse mAb
MBS435320-02 5x 0.2 mg

Renin [1N16] Mouse mAb

Sign In for Pricing
View Details
PPP1R11P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV741450 1.0 µg DNA

PPP1R11P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details