Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NEDD8-Conjugating Enzyme UBC12/UBE2M

Source: E. coli. MW :20.9kD. Recombinant Human Ubiquitin-conjugating Enzyme E2M is produced by our E.coli expression system and the target gene encoding Met1-Lys183 is expressed. UBE2M is a member of the E2 ubiquitin-conjugating enzyme family. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This protein is linked with a ubiquitin-like protein, NEDD8, which can be conjugated to cellular proteins, such as Cdc53/culin. UBE2M accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction with the E3 ubiquitin ligase RBX1, but not RBX2, suggests that the RBX1-UBE2M complex neddylates specific target proteins, such as CUL1, CUL2, CUL3 and CUL4. It involved in cell proliferation and is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation.

Product Specifications

Gene Name

UBE2M

Gene ID

9040

UniProt

P61081

Components

Supplied as a 0.2 μm filtered solution of 50mM HEPES, pH 7.5,2mM DTT,150mM NaCl,10%glycerol .

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SBNO1 (BC030544) Human Untagged Clone
SC104243 10 µg

SBNO1 (BC030544) Human Untagged Clone

Ask
View Details
pCMV-SPORT6-Coro1c Plasmid
PVT53143 2 µg

pCMV-SPORT6-Coro1c Plasmid

Ask
View Details
Rabbit Monoclonal SMPDL3A Antibody (004) [CoraFluor 1]
NBP2-90229CL1 0.1 mL

Rabbit Monoclonal SMPDL3A Antibody (004) [CoraFluor 1]

Ask
View Details
Bop1 Mouse Gene Knockout Kit (CRISPR)
KN502225 1 Kit

Bop1 Mouse Gene Knockout Kit (CRISPR)

Ask
View Details
Chlorotoluron
TRC-C421600-1G 1 g

Chlorotoluron

Ask
View Details