Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ATP-binding Cassette B5/ABCB5 (N-Trx)

Source: E. coli. MW :29.4kD. Recombinant Human ATP-binding cassette sub-family B member 5 is produced by our E.coli expression system and the target gene encoding Ile141-Val247 is expressed with a Trx tag at the N-terminus. ATP-binding cassette sub-family B member 5 (ABCB5) is a plasma membrane-spanning protein. ABCB5 is principally expressed in physiological skin and human malignant melanoma. ABCB5 has been suggested to regulate skin progenitor cell fusion and mediate chemotherapeutic drug resistance in stem-like tumor cell subpopulations in human malignant melanoma. It is commonly over-expressed on circulating melanoma tumour cells. Furthermore, the ABCB5+ melanoma- initiating cells were demonstrated to express FLT1 (VEGFR1) receptor tyrosine kinase which was functionally required for efficient xenograft tumor formation, as demonstrated by shRNA knockdown experiments.

Product Specifications

Gene Name

ABCB5

Gene ID

340273

UniProt

Q2M3G0

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMAIRSADLIVTLKDGMLAEKGAHAELMAKRGLYYSLVMSQDIKKADEQMESMTYSTERKTNSLPLHSVKSIKSDFIDKAEESTQSKEISLPEVSLLKILKLNKPEWPFV
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Human PRKCD, N-His
MBS1574490-01 0.1 mg

Recombinant Human PRKCD, N-His

Ask
View Details
Recombinant Human PRKCD, N-His
MBS1574490-02 1 mg

Recombinant Human PRKCD, N-His

Ask
View Details
Recombinant Human PRKCD, N-His
MBS1574490-03 5x 1 mg

Recombinant Human PRKCD, N-His

Ask
View Details
Mouse NEU2 siRNA
abx925757-01 15 nmol

Mouse NEU2 siRNA

Ask
View Details
Mouse NEU2 siRNA
abx925757-02 30 nmol

Mouse NEU2 siRNA

Ask
View Details
JMJD7 discontinued
390706-01 20 µL

JMJD7 discontinued

Ask
View Details