Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Parvulin-14/PIN4 (N-6His)

Source: E. coli. MW :18.8kD. Recombinant Human Parvulin-14 is produced by our E.coli expression system and the target gene encoding Met1-Lys156 is expressed with a 6His tag at the N-terminus. Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 (PIN4) is a peptidyl-prolyl cis/trans isomerase (PPIase) which interacts with NIMA and is vital for cell cycle regulation. PIN4 has 2 different isoforms: PAR14 and PAR17. Furthermore, PIN4 protein binds to double-stranded DNA under physiological salt conditions. PIN4 is involved as a ribosomal RNA processing factor in ribosome biogenesis. The PAR14 binds to tightly bent AT-rich stretches of double-stranded DNA, but PAR17 binds to double-stranded DNA.

Product Specifications

Gene Name

PIN4

Gene ID

5303

UniProt

Q9Y237

Components

Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMPMAGLLKGLVRQLEQFRVQQQASKMPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK
More Discoveries

Explore Other Products

Browse additional items from our catalog

Vom2r4 ORF Vector (Rat) (pORF)
50118016 1.0 µg DNA

Vom2r4 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
ZNF365 (NM_199450) Human Tagged Lenti ORF Clone
RC217139L4 10 µg

ZNF365 (NM_199450) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PGD Protein Vector (Human) (pPB-N-His)
PV030962 500 ng

PGD Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
INTS1 (NM_001080453) Human 3' UTR Clone
SC204321 10 µg

INTS1 (NM_001080453) Human 3' UTR Clone

Sign In for Pricing
View Details
TALAN rabbit pAb
MBS8599077-01 0.1 mL

TALAN rabbit pAb

Sign In for Pricing
View Details
TALAN rabbit pAb
MBS8599077-02 0.1 mL (AF405L)

TALAN rabbit pAb

Sign In for Pricing
View Details