Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Parvulin-14/PIN4 (N-6His)

Source: E. coli. MW :18.8kD. Recombinant Human Parvulin-14 is produced by our E.coli expression system and the target gene encoding Met1-Lys156 is expressed with a 6His tag at the N-terminus. Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 (PIN4) is a peptidyl-prolyl cis/trans isomerase (PPIase) which interacts with NIMA and is vital for cell cycle regulation. PIN4 has 2 different isoforms: PAR14 and PAR17. Furthermore, PIN4 protein binds to double-stranded DNA under physiological salt conditions. PIN4 is involved as a ribosomal RNA processing factor in ribosome biogenesis. The PAR14 binds to tightly bent AT-rich stretches of double-stranded DNA, but PAR17 binds to double-stranded DNA.

Product Specifications

Gene Name

PIN4

Gene ID

5303

UniProt

Q9Y237

Components

Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMPMAGLLKGLVRQLEQFRVQQQASKMPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Alpha- (1, 3)-fucosyltransferase, FUT7 ELISA Kit
MBS1605867-01 48 Well

Human Alpha- (1, 3)-fucosyltransferase, FUT7 ELISA Kit

Ask
View Details
Human Alpha- (1, 3)-fucosyltransferase, FUT7 ELISA Kit
MBS1605867-02 96 Well

Human Alpha- (1, 3)-fucosyltransferase, FUT7 ELISA Kit

Ask
View Details
Human Alpha- (1, 3)-fucosyltransferase, FUT7 ELISA Kit
MBS1605867-03 5x 96 Well

Human Alpha- (1, 3)-fucosyltransferase, FUT7 ELISA Kit

Ask
View Details
Human Alpha- (1, 3)-fucosyltransferase, FUT7 ELISA Kit
MBS1605867-04 10x 96 Well

Human Alpha- (1, 3)-fucosyltransferase, FUT7 ELISA Kit

Ask
View Details
Protein S Polyclonal Antibody, APC Conjugated
bs-9512R-APC-01 20 µL

Protein S Polyclonal Antibody, APC Conjugated

Ask
View Details
Protein S Polyclonal Antibody, APC Conjugated
bs-9512R-APC-02 100 µL

Protein S Polyclonal Antibody, APC Conjugated

Ask
View Details