Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast Growth Factor 17/FGF-17

Source: E. coli. MW :22.6kD. Recombinant Human Fibroblast Growth Factor 17 is produced by our E.coli expression system and the target gene encoding Thr23-Thr216 is expressed. Fibroblast Growth Factor 17 (FGF17) is a member of the heparin-binding growth factors family that is prominently expressed in the cerebellum and cortex. Proteins of this family possess broad mitogenic and cell survival activities and they are involved in a variety of biological processes including embryonic development cell growth, morphogenesis, tissue repair, tumor growth, and invasion. FGF17 plays an important role in the regulation of embryonic development and it acts as signaling molecule in the induction and patterning of the embryonic brain. In addition, FGF17 stimulates the proliferation and activation of cells that express FGF receptors.

Product Specifications

Gene Name

FGF17

Gene ID

8822

UniProt

O60258

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MTQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Endometrium
CB601649 1 Block

Frozen Tissue Blocks, Endometrium

Sign In for Pricing
View Details
Human GALT Knockout HEK293T cell line
GTR15415413 1 Vial

Human GALT Knockout HEK293T cell line

Sign In for Pricing
View Details
Anti-Pre-IL18 antibody
PAab06765 100 µg

Anti-Pre-IL18 antibody

Sign In for Pricing
View Details
ZNF460 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV805421 1.0 µg DNA

ZNF460 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
GRHPR polyclonal antibody
BS77343-01 50 µL

GRHPR polyclonal antibody

Sign In for Pricing
View Details
GRHPR polyclonal antibody
BS77343-02 100 µL

GRHPR polyclonal antibody

Sign In for Pricing
View Details