Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast Growth Factor 17/FGF-17

Source: E. coli. MW :22.6kD. Recombinant Human Fibroblast Growth Factor 17 is produced by our E.coli expression system and the target gene encoding Thr23-Thr216 is expressed. Fibroblast Growth Factor 17 (FGF17) is a member of the heparin-binding growth factors family that is prominently expressed in the cerebellum and cortex. Proteins of this family possess broad mitogenic and cell survival activities and they are involved in a variety of biological processes including embryonic development cell growth, morphogenesis, tissue repair, tumor growth, and invasion. FGF17 plays an important role in the regulation of embryonic development and it acts as signaling molecule in the induction and patterning of the embryonic brain. In addition, FGF17 stimulates the proliferation and activation of cells that express FGF receptors.

Product Specifications

Gene Name

FGF17

Gene ID

8822

UniProt

O60258

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MTQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Hydroxy-1-(3-pyridyl-2,4,5,6-d4)-1-butanone
TRC-H953006-100MG 100 mg

4-Hydroxy-1-(3-pyridyl-2,4,5,6-d4)-1-butanone

Sign In for Pricing
View Details
CREG1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV647594 1.0 µg DNA

CREG1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
C2 (NM_001145903) Human Tagged ORF Clone Lentiviral Particle
RC227665L3V 200 µL

C2 (NM_001145903) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Digoxin (2E2) Monoclonal Antibody, Cy7 Conjugated
bsm-0356M-Cy7 100 µL

Digoxin (2E2) Monoclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
MRX27 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1342106 1.0 µg DNA

MRX27 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
CPT1B, NT (Carnitine O-palmitoyltransferase 1, Muscle Isoform, CPT1-M, EC 2.3.1.21, Carnitine O-palmitoyltransferase I, Muscle Isoform, CPTI-M, CPT I, Carnitine Palmitoyltransferase 1B, Carnitine Palmitoyltransferase I-like Protein, CPT1B, KIAA1670)
MBS629195-01 0.2 mL

CPT1B, NT (Carnitine O-palmitoyltransferase 1, Muscle Isoform, CPT1-M, EC 2.3.1.21, Carnitine O-palmitoyltransferase I, Muscle Isoform, CPTI-M, CPT I, Carnitine Palmitoyltransferase 1B, Carnitine Palmitoyltransferase I-like Protein, CPT1B, KIAA1670)

Sign In for Pricing
View Details