Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human a-Taxilin/TXLNA (N, C-6His)

Source: E. coli. MW :20.4kD. Recombinant Human alpha-Taxilin is produced by our E.coli expression system and the target gene encoding Met1-Lys162 is expressed with a 6His tag at the N-terminus, 6His tag at the C-terminus. a-Taxilin belongs to the taxilin family. a-Taxilin exists in almost all tissues, with higher expression levels observed in the heart, kidney, liver, and pancreas. a-Taxilin binds to the C-terminal coiled coil region of syntaxin family members STX1A, STX3A, and STX4A, but not when these proteins are complexed with SNAP25, VAMP2 or STXBP1, suggesting that it interacts with syntaxins that do not form the SNARE complex. It is shown that a-Taxilin plays multiple roles in the generation and maintenance of neurons through modulation of the NAC-mediated translational machinary and/or the syntaxin-mediated vesicle traffic in the soma. In addition, a-Taxilin may be involved in intracellular vesicle traffic and potentially in calcium-dependent exocytosis in neuroendocrine cells.

Product Specifications

Gene Name

TXLNA

Gene ID

200081

UniProt

P40222

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMKNQDKKNGAAKQSNPKSSPGQPEAGPEGAQERPSQAAPAVEAEGPGSSQAPRKPEGAQARTAQSGALRDVSEELSRQLEDILSTYCVDNNQGGPGEDGAQGEPAEPEDAEKSRTYVARNGEPEPTPVVNGEKEPSKGDPNTEEIRQSDEVGDRDHRRPQEKLEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PLEKHA8 siRNA (Human)
CRJ3602-01 15 nmol

PLEKHA8 siRNA (Human)

Ask
View Details
PLEKHA8 siRNA (Human)
CRJ3602-02 30 nmol

PLEKHA8 siRNA (Human)

Ask
View Details
Human IgG1 (S239D/A330L/I332E), kappa Isotype Control Antibody (13R4)
ABS-484-1mg 1 mg

Human IgG1 (S239D/A330L/I332E), kappa Isotype Control Antibody (13R4)

Ask
View Details
TCO-SS-amine
HY-136039-01 5 mg

TCO-SS-amine

Ask
View Details
TCO-SS-amine
HY-136039-02 10 mg

TCO-SS-amine

Ask
View Details
IL4R (NM_001257407) Human Tagged ORF Clone
RG234914 10 µg

IL4R (NM_001257407) Human Tagged ORF Clone

Ask
View Details