Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ubiquitin-Like Protein ISG15/ISG15 (C-6His)

Source: E. coli. MW :18.2kD. Recombinant Human Interferon-stimulated Gene 15 is produced by our E.coli expression system and the target gene encoding Gly2-Gly157 is expressed with a 6His tag at the C-terminus. Ubiquitin-Like Protein ISG15 (ISG15) is a ubiquitin-like protein that becomes conjugated to many cellular proteins upon activation by interferon-alpha and -beta. Several functions have been ascribed to the encoded protein, including chemotactic activity towards neutrophils, direction of ligated target proteins to intermediate filaments, cell-to-cell signaling, and antiviral activity during viral infections. While conjugates of this protein have been found to be noncovalently attached to intermediate filaments, this protein is sometimes secreted. ISG15 becomes conjugated to a diverse set of proteins after IFN-alpha/beta stimulation or microbial challenge. The functions or biochemical consequences ISG15 conjugation to proteins are not yet known, but it appears that this modification does not target proteins for proteasomal degradation. ISG15 shows specific chemotactic activity towards neutrophils and activates them to induce release of eosinophil chemotactic factors. Upon interferon treatment, ISG15 can be detected in both free and conjugated forms, and is secreted from monocytes and lymphocytes where it can function as a cytokine. In the cell, ISG15 co-localizes with intermediate filaments and ISGylation may modulate the JAK-STAT pathway or certain aspects of neurological disease.

Product Specifications

Gene Name

ISG15

Gene ID

9636

UniProt

P05161

Components

Supplied as a 0.2 μm filtered solution of 50mM HEPES, 100mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGLEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

IRAK4 Polyclonal Antibody
E-AB-10409-01 20 µL

IRAK4 Polyclonal Antibody

Ask
View Details
IRAK4 Polyclonal Antibody
E-AB-10409-02 60 μL

IRAK4 Polyclonal Antibody

Ask
View Details
IRAK4 Polyclonal Antibody
E-AB-10409-03 120 μL

IRAK4 Polyclonal Antibody

Ask
View Details
IRAK4 Polyclonal Antibody
E-AB-10409-04 200 µL

IRAK4 Polyclonal Antibody

Ask
View Details
Rabbit anti-Caenorhabditis elegans tra-3 Polyclonal Antibody
MBS7192273 Inquire

Rabbit anti-Caenorhabditis elegans tra-3 Polyclonal Antibody

Ask
View Details
Human Lactase-Phlorizin Hydrolase (LCT) ELISA Kit
SL4535Hu-01 96 Tests

Human Lactase-Phlorizin Hydrolase (LCT) ELISA Kit

Ask
View Details