Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ubiquitin-Conjugating Enzyme E2 Variant 1/UBE2V1 (C-6His)

Source: E. coli. MW :17.5kD. Recombinant Human Ubiquitin-Conjugating Enzyme E2 Variant 1 is produced by our E.coli expression system and the target gene encoding Ala2-Asn147 is expressed with a 6His tag at the C-terminus. Ubiquitin-Conjugating Enzyme Variant 1a (UBE2V1) is a member of the Ubiquitin-conjugating (E2) enzyme family. The E2 catalytic core domain of UBE2V1 lacks an active site cysteine residue, rendering it catalytically inactive on its own. However, in the cytoplasm UBE2V1 is able to form a catalytically active complex with UBE2N/Ubc13, which mediates the synthesis Lys63-linked Ubiquitin chains and is required for NF-kappa B activation. UBE2V1 is required for UBE2N (Ubc13) /UBE2V1 Complex-dependent Lys63-linked Ubiquitin chain formation. More specifically, UBE2V1 orients the Ubiquitin molecule to favor linkage at Lys63 via a non-covalent interaction with the Ubiquitin molecule. The UBE2V1-UBE2N heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through Lys63. This type of poly-ubiquitination activates IKK and does not seem to involve protein degradation by the proteasome. UBE2V1 plays a role in the activation of NF-kappa-B mediated by IL1B, TNF, TRAF6, and TRAF2. It mediates transcriptional activation of target genes. UBE2V1 also controls the progress through the cell cycle and differentiation, the error-free DNA repair pathway and contributes to the survival of cells after DNA damage.

Product Specifications

Gene Name

UBE2V1

Gene ID

387522

UniProt

Q13404

Components

Supplied as a 0.2 μm filtered solution of 50mM HEPES, 100mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

AATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSNLEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

BBX (NM_020235) Human Tagged Lenti ORF Clone
RC223679L3 10 µg

BBX (NM_020235) Human Tagged Lenti ORF Clone

Ask
View Details
Anti-Syndecan 2 Polyclonal Antibody
MF-0090212-01 50 µL

Anti-Syndecan 2 Polyclonal Antibody

Ask
View Details
Anti-Syndecan 2 Polyclonal Antibody
MF-0090212-02 100 µL

Anti-Syndecan 2 Polyclonal Antibody

Ask
View Details
Anti-Syndecan 2 Polyclonal Antibody
MF-0090212-03 200 µL

Anti-Syndecan 2 Polyclonal Antibody

Ask
View Details
Anti-TNXB antibody
STJ25911 100 µl

Anti-TNXB antibody

Ask
View Details
Recombinant Buchnera aphidicola subsp. Melaphis rhois Tryptophan synthase alpha chain (trpA)
MBS1298681-01 0.02 mg (E-Coli)

Recombinant Buchnera aphidicola subsp. Melaphis rhois Tryptophan synthase alpha chain (trpA)

Ask
View Details