Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ubiquitin-Conjugating Enzyme E2 Z/UBE2Z (N-6His)

Source: E. coli. MW :30.2kD. Recombinant Human Ubiquitin-Conjugating Enzyme E2 Z is produced by our E.coli expression system and the target gene encoding Met1-Val246 is expressed with a 6His tag at the N-terminus. Ubiquitin-Conjugating Enzyme E2 Z (ZUBE2Z) is a member of the E2 ubiquitin-conjugating enzyme family. ZUBE2Z is widely expressed in many tissues, with high expression found in the placenta, pancreas, spleen, and testis. It is ubiquitinates proteins that catalyze the covalent attachment of ubiquitin to other proteins. It has shown that ZUBE2Z participate in signaling pathways, and may be involved in apoptosis regulation.

Product Specifications

Gene Name

UBE2Z

Gene ID

65264

UniProt

Q9H832

Components

Supplied as a 0.2 μm filtered solution of 50mM HEPES, 50mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMSIYKEPPPGMFVVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGSLRV
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

pLV3-U6-METTL27-shRNA3-Puro Plasmid
PVT60857 2 µg

pLV3-U6-METTL27-shRNA3-Puro Plasmid

Ask
View Details
hsa-miR-4717-5p miRNA Inhibitor
MBS8294362-01 10 nmol

hsa-miR-4717-5p miRNA Inhibitor

Ask
View Details
hsa-miR-4717-5p miRNA Inhibitor
MBS8294362-02 20 nmol

hsa-miR-4717-5p miRNA Inhibitor

Ask
View Details
hsa-miR-4717-5p miRNA Inhibitor
MBS8294362-03 5x 20 nmol

hsa-miR-4717-5p miRNA Inhibitor

Ask
View Details
Rabbit anti-Phospho Rad17 (5645) Antibody, Affinity Purified
A300-153A- T 10 µg

Rabbit anti-Phospho Rad17 (5645) Antibody, Affinity Purified

Ask
View Details
GFP hsa-miR-655-3p AAV miRNA Vector
Amh1096700 500 ng

GFP hsa-miR-655-3p AAV miRNA Vector

Ask
View Details