Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tubulin beta-4A Chain/TUBB4A (N-6His)

Source: E. coli. MW :51.7kD. Recombinant Human Tubulin Beta-4A Chain is produced by our E.coli expression system and the target gene encoding Met1-Ala444 is expressed with a 6His tag at the N-terminus. Tubulin Beta-4A Chain (TUBB4A) is a cytoplasmic peptide containing 444 amino acids. TUBB4A is a member of the Tubulin family. Tubulin is the major constituent of microtubules. Tubulin is a dimer composed of one alpha and one beta tubulin molecule; there are many forms of beta tubulins, Beta II and Beta IV Tubulin are ubiquitously expressed. Beta-III Tubulin, also known as Tubulin Beta-4, is regarded as a neuron-specific marker. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.

Product Specifications

Gene Name

TUBB4A

Gene ID

10382

UniProt

P04350

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM Nacl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MNHKVHHHHHHMREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEGEFEEEAEEEVAVDLQSR
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RAPGEF5 (Biotin)
574253-01 50 µg

RAPGEF5 (Biotin)

Ask
View Details
RAPGEF5 (Biotin)
574253-02 100 µg

RAPGEF5 (Biotin)

Ask
View Details
Parainfluenza Virus Type 1 (MaxLight 750)
MBS6265370-01 0.1 mL

Parainfluenza Virus Type 1 (MaxLight 750)

Ask
View Details
Parainfluenza Virus Type 1 (MaxLight 750)
MBS6265370-02 5x 0.1 mL

Parainfluenza Virus Type 1 (MaxLight 750)

Ask
View Details
Mouse Mrtfa Pre-designed siRNA Set B
SI108762B 1 Each

Mouse Mrtfa Pre-designed siRNA Set B

Ask
View Details
RhBG siRNA (h)
sc-88606 10 µM

RhBG siRNA (h)

Ask
View Details