Recombinant Human Tachykinin-3/TAC3 (N-6His)
Source: E. coli. MW :13.9kD. Recombinant Human Tachykinin-3 is produced by our E.coli expression system and the target gene encoding Gln17-Glu121 is expressed with a 6His tag at the N-terminus. Tachykinin 3 (TAC3) is a secreted protein that belongs to the Tachykinin family. Tachykinins are active peptides that excite neurons and evoke behavioral responses; they are potent vasodilators and secretagogues, and contract many smooth muscles in pregnancy. TAC3 is primarily expressed in the central and peripheral nervous systems and functions as a neurotransmitter. It is also expressed in the outer syncytiotrophoblast of the placenta and may be associated with pregnancy-induced hypertension and pre-eclampsia. TAC3 acts as the ligand for the neurokinin-3 receptor, mutations in this gene are associated with normosmic hypogonadotropic hypogonadism.
Product Specifications
Gene Name
TAC3
Gene ID
6866
UniProt
Q9UHF0
Components
Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, pH8.0.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
MGSSHHHHHHSSGLVPRGSHMQSFGAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDFFVGLMGKRSVQPDSPTDVNQENVPSFGILKYPPRAE
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items