Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tachykinin-3/TAC3 (N-6His)

Source: E. coli. MW :13.9kD. Recombinant Human Tachykinin-3 is produced by our E.coli expression system and the target gene encoding Gln17-Glu121 is expressed with a 6His tag at the N-terminus. Tachykinin 3 (TAC3) is a secreted protein that belongs to the Tachykinin family. Tachykinins are active peptides that excite neurons and evoke behavioral responses; they are potent vasodilators and secretagogues, and contract many smooth muscles in pregnancy. TAC3 is primarily expressed in the central and peripheral nervous systems and functions as a neurotransmitter. It is also expressed in the outer syncytiotrophoblast of the placenta and may be associated with pregnancy-induced hypertension and pre-eclampsia. TAC3 acts as the ligand for the neurokinin-3 receptor, mutations in this gene are associated with normosmic hypogonadotropic hypogonadism.

Product Specifications

Gene Name

TAC3

Gene ID

6866

UniProt

Q9UHF0

Components

Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, pH8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMQSFGAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDFFVGLMGKRSVQPDSPTDVNQENVPSFGILKYPPRAE

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

3- (Methylsulfonyl) -6-Oxa-3-Azabicyclo[3.1.0]Hexane
231450-01 100 mg

3- (Methylsulfonyl) -6-Oxa-3-Azabicyclo[3.1.0]Hexane

Ask
View Details
3- (Methylsulfonyl) -6-Oxa-3-Azabicyclo[3.1.0]Hexane
231450-02 250 mg

3- (Methylsulfonyl) -6-Oxa-3-Azabicyclo[3.1.0]Hexane

Ask
View Details
3- (Methylsulfonyl) -6-Oxa-3-Azabicyclo[3.1.0]Hexane
231450-03 1 g

3- (Methylsulfonyl) -6-Oxa-3-Azabicyclo[3.1.0]Hexane

Ask
View Details
3- (Methylsulfonyl) -6-Oxa-3-Azabicyclo[3.1.0]Hexane
231450-04 5 g

3- (Methylsulfonyl) -6-Oxa-3-Azabicyclo[3.1.0]Hexane

Ask
View Details
Protein FAM110B (Biotin)
330879-01 50 µg

Protein FAM110B (Biotin)

Ask
View Details
Protein FAM110B (Biotin)
330879-02 100 µg

Protein FAM110B (Biotin)

Ask
View Details