Recombinant Mouse C-C Motif Chemokine 21a/CCL21a//6Ckine
Source: E. coli. MW :12kD. Recombinant Mouse C-C Motif Chemokine 21a is produced by our E.coli expression system and the target gene encoding Ser24-Gly133 is expressed. C-C Motif Chemokine 21a (CCL21a) is a small secreted cytokine that belongs to the intercrine beta (CC chemokine) family. Mouse CCL21 cDNA encodes a 133 amino acid residue protein with a 23 residue signal peptide that is cleaved to generate the 110 residue mature protein. Mouse CCL21 has three forms while CCL21a has Ser-65. CCL21 elicits its effects by binding to a cell surface chemokine receptor known as CCR7 and CXCR3. Mouse CCL21 inhibits hemopoiesis and stimulates chemotaxis. It has chemotactic function in vitro for thymocytes and activated T-cells, but not for B-cells, macrophages, or neutrophils. Mouse CCL21 shows preferential activity towards naive T-cells and may play a role in mediating homing of lymphocytes to secondary lymphoid organs.
Product Specifications
Gene Name
Ccl21a
Gene ID
100504362
UniProt
P84444
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFSPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG
Explore Other Products
Browse additional items from our catalog