Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse C-C Motif Chemokine 21a/CCL21a//6Ckine

Source: E. coli. MW :12kD. Recombinant Mouse C-C Motif Chemokine 21a is produced by our E.coli expression system and the target gene encoding Ser24-Gly133 is expressed. C-C Motif Chemokine 21a (CCL21a) is a small secreted cytokine that belongs to the intercrine beta (CC chemokine) family. Mouse CCL21 cDNA encodes a 133 amino acid residue protein with a 23 residue signal peptide that is cleaved to generate the 110 residue mature protein. Mouse CCL21 has three forms while CCL21a has Ser-65. CCL21 elicits its effects by binding to a cell surface chemokine receptor known as CCR7 and CXCR3. Mouse CCL21 inhibits hemopoiesis and stimulates chemotaxis. It has chemotactic function in vitro for thymocytes and activated T-cells, but not for B-cells, macrophages, or neutrophils. Mouse CCL21 shows preferential activity towards naive T-cells and may play a role in mediating homing of lymphocytes to secondary lymphoid organs.

Product Specifications

Gene Name

Ccl21a

Gene ID

100504362

UniProt

P84444

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFSPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAMTS13 (NM_139025) Human Tagged ORF Clone
RG220320 10 µg

ADAMTS13 (NM_139025) Human Tagged ORF Clone

Sign In for Pricing
View Details
Tert-Butyl 4- (4- (hydroxymethyl) phenoxy) piperidine-1-carboxylate
HY-W107433 1 Each

Tert-Butyl 4- (4- (hydroxymethyl) phenoxy) piperidine-1-carboxylate

Sign In for Pricing
View Details
N-Cadherin (APC) discontinued
C0108-35G-APC 100 µL

N-Cadherin (APC) discontinued

Sign In for Pricing
View Details
TRIM11 antibody
70R-20974 50 ul

TRIM11 antibody

Sign In for Pricing
View Details
IKK gamma antibody (Ser376)
70R-32653 100 ug

IKK gamma antibody (Ser376)

Sign In for Pricing
View Details
BMP 13 antibody
20R-1737 100 ug

BMP 13 antibody

Sign In for Pricing
View Details