Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leukocyte Surface Antigen CD47/IAP/OA3 (C-Fc)

Source: Human Cells. MW :40.8kD. Recombinant Human CD47 is produced by our Mammalian expression system and the target gene encoding Gln19-Pro139 is expressed with a Fc tag at the C-terminus. CD47 is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The protein is also a receptor for the C-terminal cell-binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This protein has broad tissue distribution, and is reduced in expression on Rh erythrocytes.

Product Specifications

Gene Name

CD47

Gene ID

961

UniProt

Q08722

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-infective agent 10
HY-172230 1 Each

Anti-infective agent 10

Ask
View Details
HIV gp41 Type O, Recombinant (Human Immunodeficiency Virus gp41 Type O)
MBS635678-01 0.1 mg

HIV gp41 Type O, Recombinant (Human Immunodeficiency Virus gp41 Type O)

Ask
View Details
HIV gp41 Type O, Recombinant (Human Immunodeficiency Virus gp41 Type O)
MBS635678-02 5x 0.1 mg

HIV gp41 Type O, Recombinant (Human Immunodeficiency Virus gp41 Type O)

Ask
View Details
NFIC (Nuclear Factor 1 C-Type, Nuclear Factor I/C (CCAAT-Binding Transcription Factor) )
486830 100 µL

NFIC (Nuclear Factor 1 C-Type, Nuclear Factor I/C (CCAAT-Binding Transcription Factor) )

Ask
View Details
(tert-Butoxycarbonyl) -L-leucylglycine
HY-W039759-01 100 mg

(tert-Butoxycarbonyl) -L-leucylglycine

Ask
View Details
(tert-Butoxycarbonyl) -L-leucylglycine
HY-W039759-02 500 mg

(tert-Butoxycarbonyl) -L-leucylglycine

Ask
View Details