Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Protein S100-A13/S100A13

Source: E.coli. MW :11.3kD. Recombinant Human Protein S100-A13 is produced by our expression system and the target gene encoding Ala2-Lys98 is expressed S100A13 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. It is widely expressed in various types of tissues with a high expression level in thyroid gland. In smooth muscle cells, this protein co-expresses with other family members in the nucleus and in stress fibers, suggesting diverse functions in signal transduction. It plays a role in the export of proteins that lack a signal peptide and are secreted by an alternative pathway. It binds two calcium ions per subunit and one copper ion. Binding of one copper ion does not interfere with calcium binding. It is required for the copper-dependent stress-induced export of IL1A and FGF1. The calcium-free protein binds to lipid vesicles containing phosphatidylserine, but not to vesicles containing phosphatidylcholine.

Product Specifications

Gene Name

S100A13

Gene ID

6284

UniProt

Q99584

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH3O. Please aliquot the reconstituted solution to Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

AAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cela1 (NM_012552) Rat Tagged Lenti ORF Clone
RR205522L3 10 µg

Cela1 (NM_012552) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Canine Syndecan-3 (SDC3) ELISA Kit
MBS7249883-01 48 Well

Canine Syndecan-3 (SDC3) ELISA Kit

Sign In for Pricing
View Details
Canine Syndecan-3 (SDC3) ELISA Kit
MBS7249883-02 96 Well

Canine Syndecan-3 (SDC3) ELISA Kit

Sign In for Pricing
View Details
Canine Syndecan-3 (SDC3) ELISA Kit
MBS7249883-03 5x 96 Well

Canine Syndecan-3 (SDC3) ELISA Kit

Sign In for Pricing
View Details
Canine Syndecan-3 (SDC3) ELISA Kit
MBS7249883-04 10x 96 Well

Canine Syndecan-3 (SDC3) ELISA Kit

Sign In for Pricing
View Details
PHLPV/Allergen Phl p V Antibody
E55A12696 100 µg

PHLPV/Allergen Phl p V Antibody

Sign In for Pricing
View Details