Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Protein S100-A13/S100A13

Source: E.coli. MW :11.3kD. Recombinant Human Protein S100-A13 is produced by our expression system and the target gene encoding Ala2-Lys98 is expressed S100A13 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. It is widely expressed in various types of tissues with a high expression level in thyroid gland. In smooth muscle cells, this protein co-expresses with other family members in the nucleus and in stress fibers, suggesting diverse functions in signal transduction. It plays a role in the export of proteins that lack a signal peptide and are secreted by an alternative pathway. It binds two calcium ions per subunit and one copper ion. Binding of one copper ion does not interfere with calcium binding. It is required for the copper-dependent stress-induced export of IL1A and FGF1. The calcium-free protein binds to lipid vesicles containing phosphatidylserine, but not to vesicles containing phosphatidylcholine.

Product Specifications

Gene Name

S100A13

Gene ID

6284

UniProt

Q99584

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH3O. Please aliquot the reconstituted solution to Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

AAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MAG (Myelin-associated Glycoprotein, Siglec 4a, GMA) discontinued, see 129300
M1748-50C 50 µg

MAG (Myelin-associated Glycoprotein, Siglec 4a, GMA) discontinued, see 129300

Ask
View Details
MMP13 (Matrix Metalloproteinase 13)
048997 200 µL

MMP13 (Matrix Metalloproteinase 13)

Ask
View Details
TEKT1 CRISPRa sgRNA lentivector (set of three targets)(Human)
46482121 3x 1.0µg DNA

TEKT1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Ask
View Details
Mouse Monoclonal C3orf15 Antibody (OTI6G1) [Alexa Fluor 594]
NBP2-72309AF594 0.1 mL

Mouse Monoclonal C3orf15 Antibody (OTI6G1) [Alexa Fluor 594]

Ask
View Details
Rat 3HAO ELISA Kit
E100845 1 Each

Rat 3HAO ELISA Kit

Ask
View Details
Porcine Hypoxia Inducible Factor 2 Alpha (HIF2A) ELISA Kit
MBS9344943-01 48 Well

Porcine Hypoxia Inducible Factor 2 Alpha (HIF2A) ELISA Kit

Ask
View Details