Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Chloride Intracellular Channel Protein 1/CLIC1 (N-6His)

Source: E. coli. MW :29kD. Recombinant Human CLIC1 is produced by our E.coli expression system and the target gene encoding Met1-Lys241 is expressed with a 6His tag at the N-terminus. Chloride Intracellular Channel Protein 1 (CLIC1) belongs to the Chloride Channel CLIC family and contains one GST C-terminal domain. CLIC1 can be expressed in various cell types, but it is especially prominent in the heart, placenta, liver, kidney, and pancreas. CLIC1 can insert into membranes and form chloride ion channels. The channel activity depends on the pH. CLIC1 membrane insertion seems to be redox-regulated and may occur only under oxydizing conditions. CLIC1 is also involved in the regulation of the cell cycle.

Product Specifications

Gene Name

CLIC1

Gene ID

1192

UniProt

O00299

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Parvibaculum lavamentivorans Protein TolB (tolB)
MBS1044842-01 0.02 mg (E-Coli)

Recombinant Parvibaculum lavamentivorans Protein TolB (tolB)

Ask
View Details
Recombinant Parvibaculum lavamentivorans Protein TolB (tolB)
MBS1044842-02 0.02 mg (Yeast)

Recombinant Parvibaculum lavamentivorans Protein TolB (tolB)

Ask
View Details
Recombinant Parvibaculum lavamentivorans Protein TolB (tolB)
MBS1044842-03 0.1 mg (E-Coli)

Recombinant Parvibaculum lavamentivorans Protein TolB (tolB)

Ask
View Details
Recombinant Parvibaculum lavamentivorans Protein TolB (tolB)
MBS1044842-04 0.1 mg (Yeast)

Recombinant Parvibaculum lavamentivorans Protein TolB (tolB)

Ask
View Details
Recombinant Parvibaculum lavamentivorans Protein TolB (tolB)
MBS1044842-05 0.02 mg (Baculovirus)

Recombinant Parvibaculum lavamentivorans Protein TolB (tolB)

Ask
View Details
Recombinant Parvibaculum lavamentivorans Protein TolB (tolB)
MBS1044842-06 0.02 mg (Mammalian-Cell)

Recombinant Parvibaculum lavamentivorans Protein TolB (tolB)

Ask
View Details