Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human MHC Class I Polypeptide-Related Sequence A/MICA (C-Fc)

Source: Human Cells. MW :59.9kD. Recombinant Human MHC Class I-related Protein A is produced by our Mammalian expression system and the target gene encoding Ala23-Glu308 is expressed with a Fc tag at the C-terminus. MHC class I polypeptide-related sequence A, also known as MIC-A, PERB11.1 and MICA, is a single-pass type I membrane protein which belongs to the MHC class I family of MIC subfamily. MICA contains one Ig-like C1-type domain and is expressed on the cell surface, although unlike canonical class I molecules does not seem to associate with beta-2-microglobulin. It is thought that MICA functions as a stress-induced antigen that is broadly recognized by NK cells, NKT cells, and most of the subtypes of T cells. MICA is the ligand for NK cell activating receptor KLRK1/NKG2D. MICA seems to have no role in antigen presentation. MICA leads to cell lysis by binding to KLRK1.

Product Specifications

Gene Name

MICA

Gene ID

100507436

UniProt

Q29983

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

AEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SMARCA4 Antibody
MBS9409087-01 0.1 mL

SMARCA4 Antibody

Ask
View Details
SMARCA4 Antibody
MBS9409087-02 5x 0.1 mL

SMARCA4 Antibody

Ask
View Details
Interleukin 12 (IL-12, Cytotoxic Lymphocyte Maturation Factor 1, CTL Maturation Factor, TcMF, CLMF p35, Natural Killer Cell Stimulatory Factor 1, NFSK1, p35, T cell Stimulating Factor, TSF) (MaxLight 650)
I8434-08C-ML650 100 µL

Interleukin 12 (IL-12, Cytotoxic Lymphocyte Maturation Factor 1, CTL Maturation Factor, TcMF, CLMF p35, Natural Killer Cell Stimulatory Factor 1, NFSK1, p35, T cell Stimulating Factor, TSF) (MaxLight 650)

Ask
View Details
Mouse Monoclonal LAMP-1/CD107a Antibody (LY1C6) [DyLight 350]
NB100-1952UV 0.1 mL

Mouse Monoclonal LAMP-1/CD107a Antibody (LY1C6) [DyLight 350]

Ask
View Details
DiagNano Recombinant Syphilis (15 kDa) Conjugated Gold Nanoparticles
DAGC578-01 5 mL

DiagNano Recombinant Syphilis (15 kDa) Conjugated Gold Nanoparticles

Ask
View Details
DiagNano Recombinant Syphilis (15 kDa) Conjugated Gold Nanoparticles
DAGC578-02 1 mg

DiagNano Recombinant Syphilis (15 kDa) Conjugated Gold Nanoparticles

Ask
View Details