Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human PDCD5/TFAR19 (N-6His)

Source: E. coli. MW :16.4kD. Recombinant Human Programmed Cell Death Protein 5 is produced by our E.coli expression system and the target gene encoding Met1-Tyr125 is expressed with a 6His tag at the N-terminus. Programmed Cell Death Protein 5 (PDCD5) is a member of the PDCD5 family. PDCD5 is expressed in tumor cells during apoptosis, independent of apoptosis-inducing stimuli. This protein may function in the process of apoptosis. PDCD5 is upregulated during apoptosis where it translocates rapidly from the cytoplasm to the nucleus. PDCD5 may play an important regulator of K (lysine) acetyltransferase 5 (a protein involved in transcription, DNA damage response and cell cycle control) by inhibiting its proteasome-dependent degradation. PDCD5 is an important novel protein that regulates both apoptotic and non-apoptotic programmed cell death.

Product Specifications

Gene Name

PDCD5

Gene ID

9141

UniProt

O14737

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal ILT2/CD85j/LILRB1 Antibody (VMP55) [DyLight 488]
NBP3-08822G 100 µL

Mouse Monoclonal ILT2/CD85j/LILRB1 Antibody (VMP55) [DyLight 488]

Ask
View Details
Cystatin A (Stefin A, Cystatin-A, Cystatin-AS, Stefin-A, CSTA, STF1, STFA) (APC)
125607-APC 100 µL

Cystatin A (Stefin A, Cystatin-A, Cystatin-AS, Stefin-A, CSTA, STF1, STFA) (APC)

Ask
View Details
FLJ46838 Human shRNA Plasmid Kit (Locus ID 440865)
TL319590 1 Kit

FLJ46838 Human shRNA Plasmid Kit (Locus ID 440865)

Ask
View Details
Pancreas cancer tissue array with pancreas tissue, including pathology grade, TNM, clinical stage, 96 cases/96 cores
DPA961 96 Cases / 96 Cores

Pancreas cancer tissue array with pancreas tissue, including pathology grade, TNM, clinical stage, 96 cases/96 cores

Ask
View Details
Recombinant Plasmodium berghei Probable DNA-directed RNA polymerase II subunit RPB11 (PB000758.01.0)
MBS1443632-01 0.02 mg (E-Coli)

Recombinant Plasmodium berghei Probable DNA-directed RNA polymerase II subunit RPB11 (PB000758.01.0)

Ask
View Details
Recombinant Plasmodium berghei Probable DNA-directed RNA polymerase II subunit RPB11 (PB000758.01.0)
MBS1443632-02 0.1 mg (E-Coli)

Recombinant Plasmodium berghei Probable DNA-directed RNA polymerase II subunit RPB11 (PB000758.01.0)

Ask
View Details