Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sulfotransferase 1A3/SULT1A3 (N-6His)

Source: E. coli. MW :35.6kD. Recombinant Human Sulfotransferase 1A3 is produced by our E.coli expression system and the target gene encoding Met1-Leu295 is expressed with a 6His tag at the N-terminus. Sulfotransferase 1A3/1A4 (SULT1A3) is 295 amino acids in length and localizes to the cytoplasm. It is a member of the Sulfotransferase 1 family. SULT1A3 can be found in the liver, colon, kidney, lung, brain, spleen, small intestine, placenta, and leukocytes. SULT1A3 exists as a homodimer and it catalyzes the sulfation of phenolic monoamines, such as dopamine, norepinephrine and serotonin, and phenolic and catecholic drugs.

Product Specifications

Gene Name

SULT1A3

Gene ID

105369243

UniProt

P50224

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris,100mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MNHKVHHHHHHMELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TRUB1 (NM_139169) Human Tagged Lenti ORF Clone
RC205513L3 10 µg

TRUB1 (NM_139169) Human Tagged Lenti ORF Clone

Ask
View Details
RNF11 Rabbit pAb (APR28124N)
APR28124N-01 50 µL

RNF11 Rabbit pAb (APR28124N)

Ask
View Details
RNF11 Rabbit pAb (APR28124N)
APR28124N-02 100 µL

RNF11 Rabbit pAb (APR28124N)

Ask
View Details
RNF11 Rabbit pAb (APR28124N)
APR28124N-03 200 µL

RNF11 Rabbit pAb (APR28124N)

Ask
View Details
Histone H2A-Bbd Blocking Peptide
MBS9622169-01 1 mg

Histone H2A-Bbd Blocking Peptide

Ask
View Details
Histone H2A-Bbd Blocking Peptide
MBS9622169-02 5x 1 mg

Histone H2A-Bbd Blocking Peptide

Ask
View Details