Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human N-Acetylneuraminate Synthase/NANS/SAS (N-6His)

Source: E. coli. MW :42.4kD. Recombinant Human N-Acetylneuraminate Synthase is produced by our E.coli expression system and the target gene encoding Met1-Ser359 is expressed with a 6His tag at the N-terminus. Sialic Acid Synthase (NANS) is an enzyme that contains one AFP-like domain. NANS is ubiquitous and plays a role in the biosynthetic pathways of sialic acids. NANS produces N-acetylneuraminic acid (Neu5Ac) and 2-keto-3-deoxy-D-glycero-D-galacto-nononic acid (KDN) . It also can use N-acetylmannosamine 6-phosphate and mannose 6-phosphate as substrates to generate phosphorylated forms of Neu5Ac and KDN, respectively.

Product Specifications

Gene Name

NANS

Gene ID

54187

UniProt

Q9NR45

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris, 100mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMPLELELCPGRWVGGQHPCFIIAEIGQNHQGDLDVAKRMIRMAKECGADCAKFQKSELEFKFNRKALDRPYTSKHSWGKTYGEHKRHLEFSHDQYRELQRYAEEVGIFFTASGMDEMAVEFLHELNVPFFKVGSGDTNNFPYLEKTAKKGRPMVISSGMQSMDTMKQVYQIVKPLNPNFCFLQCTSAYPLQPEDVNLRVISEYQKLFPDIPIGYSGHETGIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVRLVERALGSPTKQLLPCEMACNEKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELVDNHGKKIKS
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral mouse Rit1 shRNA (UAS) - Lentiviral mouse Rit1 shRNA (UAS) (25)
GTR15179009 1 Vial

Lentiviral mouse Rit1 shRNA (UAS) - Lentiviral mouse Rit1 shRNA (UAS) (25)

Ask
View Details
LentimiRa-Off-hsa-miR-1908-5p Vector
mh30261 500 ng

LentimiRa-Off-hsa-miR-1908-5p Vector

Ask
View Details
VPS53 cDNA Clone
MBS1270065-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

VPS53 cDNA Clone

Ask
View Details
VPS53 cDNA Clone
MBS1270065-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

VPS53 cDNA Clone

Ask
View Details
KLHL36 cDNA Clone
MBS1274786-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

KLHL36 cDNA Clone

Ask
View Details
KLHL36 cDNA Clone
MBS1274786-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

KLHL36 cDNA Clone

Ask
View Details