Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human N-Acetylneuraminate Synthase/NANS/SAS (N-6His)

Source: E. coli. MW :42.4kD. Recombinant Human N-Acetylneuraminate Synthase is produced by our E.coli expression system and the target gene encoding Met1-Ser359 is expressed with a 6His tag at the N-terminus. Sialic Acid Synthase (NANS) is an enzyme that contains one AFP-like domain. NANS is ubiquitous and plays a role in the biosynthetic pathways of sialic acids. NANS produces N-acetylneuraminic acid (Neu5Ac) and 2-keto-3-deoxy-D-glycero-D-galacto-nononic acid (KDN) . It also can use N-acetylmannosamine 6-phosphate and mannose 6-phosphate as substrates to generate phosphorylated forms of Neu5Ac and KDN, respectively.

Product Specifications

Gene Name

NANS

Gene ID

54187

UniProt

Q9NR45

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris, 100mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMPLELELCPGRWVGGQHPCFIIAEIGQNHQGDLDVAKRMIRMAKECGADCAKFQKSELEFKFNRKALDRPYTSKHSWGKTYGEHKRHLEFSHDQYRELQRYAEEVGIFFTASGMDEMAVEFLHELNVPFFKVGSGDTNNFPYLEKTAKKGRPMVISSGMQSMDTMKQVYQIVKPLNPNFCFLQCTSAYPLQPEDVNLRVISEYQKLFPDIPIGYSGHETGIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVRLVERALGSPTKQLLPCEMACNEKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELVDNHGKKIKS
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Gpr4 (NM_001025680) Rat Tagged ORF Clone Lentiviral Particle
RR204537L3V 200 µL

Gpr4 (NM_001025680) Rat Tagged ORF Clone Lentiviral Particle

Ask
View Details
CHGB Antibody
A17226-50UG 50 µg

CHGB Antibody

Ask
View Details
OTUD7B (OTU Domain-containing Protein 7B, Cellular Zinc Finger Anti-NF-kappa-B Protein, Zinc Finger A20 Domain-containing Protein 1, ZA20D1, Zinc Finger Protein Cezanne) (MaxLight 490)
MBS6204137-01 0.1 mL

OTUD7B (OTU Domain-containing Protein 7B, Cellular Zinc Finger Anti-NF-kappa-B Protein, Zinc Finger A20 Domain-containing Protein 1, ZA20D1, Zinc Finger Protein Cezanne) (MaxLight 490)

Ask
View Details
OTUD7B (OTU Domain-containing Protein 7B, Cellular Zinc Finger Anti-NF-kappa-B Protein, Zinc Finger A20 Domain-containing Protein 1, ZA20D1, Zinc Finger Protein Cezanne) (MaxLight 490)
MBS6204137-02 5x 0.1 mL

OTUD7B (OTU Domain-containing Protein 7B, Cellular Zinc Finger Anti-NF-kappa-B Protein, Zinc Finger A20 Domain-containing Protein 1, ZA20D1, Zinc Finger Protein Cezanne) (MaxLight 490)

Ask
View Details
Rat Actin-related protein 2 (ACTR2) ELISA Kit
MBS7242578-01 48 Well

Rat Actin-related protein 2 (ACTR2) ELISA Kit

Ask
View Details
Rat Actin-related protein 2 (ACTR2) ELISA Kit
MBS7242578-02 96 Well

Rat Actin-related protein 2 (ACTR2) ELISA Kit

Ask
View Details