Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sulfotransferase 1A1/SULT1A1 (N-6His)

Source: E. coli. MW :35.5kD. Recombinant Human Sulfotransferase 1A1 is produced by our E.coli expression system and the target gene encoding Met1-Leu295 is expressed with a 6His tag at the N-terminus. Sulfotransferase 1A1 (SULT1A1) is a cytosolic sulfotransferases that is expressed in the liver, lung, adrenal, brain, platelets, and skin. SULT1A1 is a phenol sulfotransferases with thermostable enzyme activity. SULT1A1 utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters. It is responsible for the sulfonation and activation of minoxidil. SULT1A1 mediates the metabolic activation of carcinogenic N-hydroxyarylamines to DNA binding products and could so participate as modulating factor of cancer risk.

Product Specifications

Gene Name

SULT1A1

Gene ID

6817

UniProt

P50225

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,1mM EDTA, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MNHKVHHHHHHMELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

S100A7 (S100 Calcium Binding Protein A7, PSOR1, S100A7c) (HRP)
251389-HRP 100 µL

S100A7 (S100 Calcium Binding Protein A7, PSOR1, S100A7c) (HRP)

Ask
View Details
Mouse Jsrp1 activation kit by CRISPRa
GA209016 1 Kit

Mouse Jsrp1 activation kit by CRISPRa

Ask
View Details
Monoclonal Anti-Ampicillin
BDA1045 1 mg

Monoclonal Anti-Ampicillin

Ask
View Details
Mycb, CT (Mycb, Bmyc, Protein B-Myc) (Biotin) discontinued
038720-Biotin 200 µL

Mycb, CT (Mycb, Bmyc, Protein B-Myc) (Biotin) discontinued

Ask
View Details
Rabbit anti-Escherichia coli O1:K1/APEC YFBV Polyclonal Antibody
MBS7166987 Inquire

Rabbit anti-Escherichia coli O1:K1/APEC YFBV Polyclonal Antibody

Ask
View Details
TRIP (TRAIP) Mouse Monoclonal Antibody [Clone ID: LBI1G3]
AMM14352V 100 µL

TRIP (TRAIP) Mouse Monoclonal Antibody [Clone ID: LBI1G3]

Ask
View Details