Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Stem Cell Factor/SCF (C-6His)

Source: E.coli. MW :19.3kD. Recombinant Rat Stem Cell Factor is produced by our E.coli expression system and the target gene encoding Gln26-Ala189 is expressed with a 6His tag at the C-terminus. Stem cell factor (SCF), is the ligand for the receptor-type protein-tyrosine kinase KIT. It plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. It also promotes phosphorylation of PIK3R1, which is the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5.

Product Specifications

Gene Name

Kitlg

Gene ID

60427

UniProt

P21581

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MQEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVAHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCI Polyclonal Antibody
MBS2535430-01 0.02 mL

DCI Polyclonal Antibody

Sign In for Pricing
View Details
DCI Polyclonal Antibody
MBS2535430-02 0.06 mL

DCI Polyclonal Antibody

Sign In for Pricing
View Details
DCI Polyclonal Antibody
MBS2535430-03 0.12 mL

DCI Polyclonal Antibody

Sign In for Pricing
View Details
DCI Polyclonal Antibody
MBS2535430-04 0.2 mL

DCI Polyclonal Antibody

Sign In for Pricing
View Details
Rat Vitamin E (VE) Elisa kit
EIA06516r 1 Kit

Rat Vitamin E (VE) Elisa kit

Sign In for Pricing
View Details
HDGF2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV814032 1.0 µg DNA

HDGF2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details