Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Caspase-10/CASP10 (C-6His)

Source: E. coli. MW :30.1kD. Recombinant Human Caspase-10 is produced by our E.coli expression system and the target gene encoding Val220-Ile480 is expressed with a 6His tag at the C-terminus. Caspase-10 (CASP10) is a 521 amino acid protein member of the Cysteine-Aspartic Acid Protease (Caspase) family. CASP10 contains two DED (Death Effector) domains and is detectable in most tissues. CASP10 cleavage by Granzyme B and autocatalytic activity generate the two active subunits: Caspase-10 subunit p23/17, Caspase-10 subunit p12. Caspases are a family of cytosolic aspartate-specific cysteine proteases involved in the execution-phase of cell apoptosis, the initiation and execution. Human caspases can be subdivided into three functional groups: cytokine activation (caspase-1, -4, -5, and -13), apoptosis initiation (caspase-2, -8, -9, -and -10), and apoptosis execution (caspase-3, -6, and -7) . CASP10 cleaves and activates caspases 3 and 7, but itself is processed by caspase 8. Defects in CASP10 are associated with apoptosis defects seen in type II autoimmune lymphoproliferative syndrome.

Product Specifications

Gene Name

CASP10

Gene ID

843

UniProt

Q92851

Components

Supplied as a 0.2 μm filtered solution of 25mM HEPES, 10mM DTT, pH 7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MVKTFLEALPQESWQNKHAGSNGNRATNGAPSLVSRGMQGASANTLNSETSTKRAAVYRMNRNHRGLCVIVNNHSFTSLKDRQGTHKDAEILSHVFQWLGFTVHIHNNVTKVEMEMVLQKQKCNPAHADGDCFVFCILTHGRFGAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFIQACQGEEIQPSVSIEADALNPEQAPTSLQDSIPAEADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKKLVPRHEDILSILEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ASPH
enz-488 5µg

ASPH

Ask
View Details
C9orf23 (RPP25L) (NM_148178) Human Untagged Clone
SC306316 10 µg

C9orf23 (RPP25L) (NM_148178) Human Untagged Clone

Ask
View Details
ZNF549 Polyclonal Conjugated Antibody
MBS9442094-01 0.1 mL (Biotin)

ZNF549 Polyclonal Conjugated Antibody

Ask
View Details
ZNF549 Polyclonal Conjugated Antibody
MBS9442094-02 0.1 mL (AF350)

ZNF549 Polyclonal Conjugated Antibody

Ask
View Details
ZNF549 Polyclonal Conjugated Antibody
MBS9442094-03 0.1 mL (AF405)

ZNF549 Polyclonal Conjugated Antibody

Ask
View Details
ZNF549 Polyclonal Conjugated Antibody
MBS9442094-04 0.1 mL (AF488)

ZNF549 Polyclonal Conjugated Antibody

Ask
View Details