Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sulfotransferase 2A1/SULT2A1 (N-6His)

Source: E. coli. MW :35.2kD. Recombinant Human Sulfotransferase 2A1 is produced by our E.coli expression system and the target gene encoding Ser2-Glu285 is expressed with a 6His tag at the N-terminus. Bile Salt Sulfotransferase (SULT2A1 (is a cytosolic enzyme that belongs to the Sulfotransferase 1 family. SULT2A1 is primarily expressed in the liver and adrenal tissues, and to a lesser extent in the kidney. SULT2A1 utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor, and it catalyze the sulfonation of steroids and bile acids in the liver and adrenal glands. SULT2A1 may have a role in the inherited adrenal androgen excess.

Product Specifications

Gene Name

SULT2A1

Gene ID

6822

UniProt

Q06520

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris, 100mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MNHKVHHHHHHMSDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD74 (BU45), CF568 conjugate, 0.1mg/mL
BNC680189-500 1x 500 µL

CD74 (BU45), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL
BNC940050-100 1x 100 µL

IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF647 conjugate, 0.1mg/mL
BNC472853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF488A conjugate, 0.1mg/mL
BNC880003-100 1x 100 µL

CD45RO (UCHL-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF568 conjugate, 0.1mg/mL
BNC682853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF647 conjugate, 0.1mg/mL
BNC470176-100 1x 100 µL

CD5 (Cris-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details