Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sulfotransferase 2A1/SULT2A1 (N-6His)

Source: E. coli. MW :35.2kD. Recombinant Human Sulfotransferase 2A1 is produced by our E.coli expression system and the target gene encoding Ser2-Glu285 is expressed with a 6His tag at the N-terminus. Bile Salt Sulfotransferase (SULT2A1 (is a cytosolic enzyme that belongs to the Sulfotransferase 1 family. SULT2A1 is primarily expressed in the liver and adrenal tissues, and to a lesser extent in the kidney. SULT2A1 utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor, and it catalyze the sulfonation of steroids and bile acids in the liver and adrenal glands. SULT2A1 may have a role in the inherited adrenal androgen excess.

Product Specifications

Gene Name

SULT2A1

Gene ID

6822

UniProt

Q06520

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris, 100mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MNHKVHHHHHHMSDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Superoxide Dismutase Antibody Peroxidase Conjugated
B2024950 25 µL

Superoxide Dismutase Antibody Peroxidase Conjugated

Ask
View Details
TCS 1102
3818/50 50 mg

TCS 1102

Ask
View Details
Rabbit Polyclonal LARS Antibody
NBP2-32208 100 µL

Rabbit Polyclonal LARS Antibody

Ask
View Details
AKR7A2 (aldo-keto Reductase Family 7, Member A2 (aflatoxin aldehyde Reductase), AFAR, AFAR1, AFB1-AR1, AKR7) (MaxLight 490)
MBS6205112-01 0.1 mL

AKR7A2 (aldo-keto Reductase Family 7, Member A2 (aflatoxin aldehyde Reductase), AFAR, AFAR1, AFB1-AR1, AKR7) (MaxLight 490)

Ask
View Details
AKR7A2 (aldo-keto Reductase Family 7, Member A2 (aflatoxin aldehyde Reductase), AFAR, AFAR1, AFB1-AR1, AKR7) (MaxLight 490)
MBS6205112-02 5x 0.1 mL

AKR7A2 (aldo-keto Reductase Family 7, Member A2 (aflatoxin aldehyde Reductase), AFAR, AFAR1, AFB1-AR1, AKR7) (MaxLight 490)

Ask
View Details