Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sulfotransferase 1C2/SULT1C2 (N-6His)

Source: E. coli. MW :36.3kD. Recombinant Human Sulfotransferase 1C2 is produced by our E.coli expression system and the target gene encoding Met1-Leu296 is expressed with a 6His tag at the N-terminus. Sulfotransferase 1C2 (SULT1C2) is a cytosolic enzyme member of the Sulfotransferase 1 family. Human SULT1C2 is primarily expressed in the adult stomach, kidney and thyroid gland, and in the fetal kidney and liver. SULT1C2 catalyzes the sulfate conjugation of drugs, xenobiotic compounds, hormones, and neurotransmitters. SULT1C2 may be involved in the activation of carcinogenic hyroxylamines. It shows activity towards p-nitrophenol and N-hydroxy-2-acetylamino-fluorene (N-OH-2AAF) .

Product Specifications

Gene Name

SULT1C2

Gene ID

6819

UniProt

O00338

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris, 0.1M NaCl, pH 8.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MNHKVHHHHHHMALTSDLGKQIKLKEVEGTLLQPATVDNWSQIQSFEAKPDDLLICTYPKAGTTWIQEIVDMIEQNGDVEKCQRAIIQHRHPFIEWARPPQPSGVEKAKAMPSPRILKTHLSTQLLPPSFWENNCKFLYVARNAKDCMVSYYHFQRMNHMLPDPGTWEEYFETFINGKVVWGSWFDHVKGWWEMKDRHQILFLFYEDIKRDPKHEIRKVMQFMGKKVDETVLDKIVQETSFEKMKENPMTNRSTVSKSILDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMEL
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MRGBP Antibody (Center) [APR31618G]
APR31618G-01 50 µL

MRGBP Antibody (Center) [APR31618G]

Ask
View Details
MRGBP Antibody (Center) [APR31618G]
APR31618G-02 100 µL

MRGBP Antibody (Center) [APR31618G]

Ask
View Details
MRGBP Antibody (Center) [APR31618G]
APR31618G-03 200 µL

MRGBP Antibody (Center) [APR31618G]

Ask
View Details
MRGBP Antibody (Center) [APR31618G]
APR31618G-04 400 µL

MRGBP Antibody (Center) [APR31618G]

Ask
View Details
NOTUM (NM_178493) Human Tagged Lenti ORF Clone
RC209331L2 10 µg

NOTUM (NM_178493) Human Tagged Lenti ORF Clone

Ask
View Details
Lentiviral mouse Kifap3 shRNA (UAS) - Lentiviral mouse Kifap3 shRNA (UAS) (25)
GTR15213473 1 Vial

Lentiviral mouse Kifap3 shRNA (UAS) - Lentiviral mouse Kifap3 shRNA (UAS) (25)

Ask
View Details