Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sulfotransferase 1B1/SULT1B1 (N-6His)

Source: E. coli. MW :36.3kD. Recombinant Human Sulfotransferase 1B1 is produced by our E.coli expression system and the target gene encoding Met1-Ile296 is expressed with a 6His tag at the N-terminus. Sulfotransferase Family Cytosolic 1B Member 1 (SULT1B1) is a cytosolic enzyme that belongs to the Sulfotransferase 1 family. Human SULT1B1 is a 296 amino acid protein that is highly expressed in the liver, peripheral blood leukocytes, colon, small intestine, and spleen. SULT1B1 utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor, and it can catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds.

Product Specifications

Gene Name

SULT1B1

Gene ID

27284

UniProt

O43704

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris, 0.1M NaCl, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MNHKVHHHHHHMLSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFWENNCKMIYLARNAKDVSVSYYHFDLMNNLQPFPGTWEEYLEKFLTGKVAYGSWFTHVKNWWKRKEEHPILFLYYEDMKENPKEEIKKIIRFLEKNLNDEILDRIIHHTSFEVMKDNPLVNYTHLPTTVMDHSKSPFMRKGTAGDWKNYFTVAQNEKFDAIYETEMSKTALQFRTEI
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

rno-miR-30d-5p miRNA Inhibitor
MBS8297368-01 10 nmol

rno-miR-30d-5p miRNA Inhibitor

Ask
View Details
rno-miR-30d-5p miRNA Inhibitor
MBS8297368-02 20 nmol

rno-miR-30d-5p miRNA Inhibitor

Ask
View Details
rno-miR-30d-5p miRNA Inhibitor
MBS8297368-03 5x 20 nmol

rno-miR-30d-5p miRNA Inhibitor

Ask
View Details
XLD HiVeg® Agar
MV031-500G 500 g

XLD HiVeg® Agar

Ask
View Details
Human EEF1A1 qPCR Primer Pair
QH02477S 200 Tests

Human EEF1A1 qPCR Primer Pair

Ask
View Details
Mmu-miR-3088-5p mimic
HY-R02966-01 5 nmol

Mmu-miR-3088-5p mimic

Ask
View Details